Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364L734

Protein Details
Accession A0A364L734    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
245-264IKQHDEKYTRPKPKYKPFTGBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11.333, cyto_mito 6.666, cyto 6.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036241  NSFL1C_SEP_dom_sf  
IPR012989  SEP_domain  
IPR009060  UBA-like_sf  
IPR029071  Ubiquitin-like_domsf  
IPR001012  UBX_dom  
Pfam View protein in Pfam  
PF08059  SEP  
PF14555  UBA_4  
PF00789  UBX  
PROSITE View protein in PROSITE  
PS51399  SEP  
PS50033  UBX  
CDD cd14348  UBA_p47  
cd01770  UBX_UBXN2  
Amino Acid Sequences MASNLSQDEILSQFCAMTGARPFLDTNQWDLDAAVTEFFADQEEEELLQDTEALGGRRLGTDSSDEAETAASRSSAHTSGQSSSRRAPSKKFATLGDLTSGGGRDSGNEDDENQDFFAGGEKSGLAVQNPDDIKQKILEKAMRAKPPQPDDSETRKSHFTGAARTLGGDDTPSQVIQDPNENRPTPPPRVQRTLHFWSDGFSVDDGDLYRSDDPQNASILEGIRRGRAPLSIMNVAPGQEVDVEIKQHDEKYTRPKPKYKPFTGSGQRLGSPTPAIRTSQPEPAAAPASSEPAKPDIDESQPVVTLQIRLGDGTRLTSRFNTTHTIGDVYSFVAAASPASRSRAWILMTTFPSKELADKAAVLGELPDFKRGGVVVQKWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.09
4 0.12
5 0.14
6 0.17
7 0.17
8 0.19
9 0.2
10 0.21
11 0.3
12 0.27
13 0.29
14 0.28
15 0.28
16 0.27
17 0.26
18 0.24
19 0.18
20 0.16
21 0.12
22 0.09
23 0.08
24 0.08
25 0.08
26 0.08
27 0.07
28 0.06
29 0.07
30 0.09
31 0.08
32 0.09
33 0.11
34 0.09
35 0.09
36 0.09
37 0.07
38 0.08
39 0.09
40 0.1
41 0.09
42 0.1
43 0.11
44 0.12
45 0.13
46 0.12
47 0.11
48 0.14
49 0.15
50 0.16
51 0.16
52 0.15
53 0.14
54 0.14
55 0.13
56 0.11
57 0.1
58 0.07
59 0.07
60 0.09
61 0.12
62 0.13
63 0.14
64 0.16
65 0.18
66 0.21
67 0.27
68 0.3
69 0.3
70 0.35
71 0.42
72 0.47
73 0.48
74 0.51
75 0.54
76 0.59
77 0.61
78 0.57
79 0.5
80 0.49
81 0.48
82 0.43
83 0.35
84 0.27
85 0.21
86 0.19
87 0.18
88 0.11
89 0.1
90 0.08
91 0.07
92 0.1
93 0.11
94 0.12
95 0.12
96 0.13
97 0.15
98 0.16
99 0.16
100 0.13
101 0.11
102 0.09
103 0.09
104 0.12
105 0.09
106 0.08
107 0.08
108 0.08
109 0.08
110 0.09
111 0.1
112 0.07
113 0.07
114 0.08
115 0.13
116 0.14
117 0.15
118 0.18
119 0.18
120 0.19
121 0.21
122 0.23
123 0.21
124 0.26
125 0.27
126 0.27
127 0.36
128 0.42
129 0.45
130 0.45
131 0.47
132 0.49
133 0.51
134 0.52
135 0.46
136 0.44
137 0.43
138 0.49
139 0.52
140 0.46
141 0.43
142 0.41
143 0.37
144 0.35
145 0.33
146 0.26
147 0.24
148 0.25
149 0.25
150 0.23
151 0.22
152 0.2
153 0.17
154 0.15
155 0.1
156 0.08
157 0.07
158 0.08
159 0.07
160 0.07
161 0.09
162 0.09
163 0.09
164 0.17
165 0.17
166 0.21
167 0.26
168 0.26
169 0.25
170 0.31
171 0.36
172 0.34
173 0.4
174 0.45
175 0.45
176 0.51
177 0.52
178 0.5
179 0.53
180 0.53
181 0.46
182 0.39
183 0.33
184 0.28
185 0.27
186 0.23
187 0.16
188 0.1
189 0.09
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.07
196 0.08
197 0.08
198 0.09
199 0.11
200 0.12
201 0.13
202 0.13
203 0.12
204 0.12
205 0.12
206 0.12
207 0.11
208 0.13
209 0.12
210 0.13
211 0.13
212 0.13
213 0.13
214 0.13
215 0.14
216 0.14
217 0.17
218 0.18
219 0.18
220 0.18
221 0.18
222 0.17
223 0.15
224 0.12
225 0.08
226 0.06
227 0.06
228 0.07
229 0.07
230 0.07
231 0.08
232 0.1
233 0.1
234 0.11
235 0.13
236 0.14
237 0.18
238 0.28
239 0.37
240 0.45
241 0.51
242 0.59
243 0.66
244 0.76
245 0.82
246 0.78
247 0.76
248 0.7
249 0.73
250 0.73
251 0.69
252 0.64
253 0.56
254 0.5
255 0.43
256 0.41
257 0.32
258 0.25
259 0.21
260 0.18
261 0.17
262 0.18
263 0.19
264 0.25
265 0.26
266 0.31
267 0.31
268 0.28
269 0.28
270 0.28
271 0.29
272 0.22
273 0.21
274 0.15
275 0.17
276 0.18
277 0.17
278 0.16
279 0.16
280 0.17
281 0.15
282 0.17
283 0.17
284 0.19
285 0.21
286 0.22
287 0.2
288 0.2
289 0.2
290 0.19
291 0.16
292 0.14
293 0.12
294 0.13
295 0.12
296 0.12
297 0.13
298 0.14
299 0.13
300 0.16
301 0.19
302 0.17
303 0.19
304 0.21
305 0.26
306 0.25
307 0.28
308 0.29
309 0.28
310 0.29
311 0.29
312 0.28
313 0.23
314 0.23
315 0.2
316 0.15
317 0.13
318 0.1
319 0.08
320 0.07
321 0.07
322 0.06
323 0.07
324 0.09
325 0.1
326 0.14
327 0.14
328 0.17
329 0.2
330 0.23
331 0.24
332 0.27
333 0.28
334 0.32
335 0.36
336 0.38
337 0.35
338 0.31
339 0.32
340 0.27
341 0.27
342 0.23
343 0.22
344 0.2
345 0.2
346 0.2
347 0.2
348 0.19
349 0.16
350 0.14
351 0.12
352 0.16
353 0.17
354 0.19
355 0.17
356 0.17
357 0.19
358 0.18
359 0.22
360 0.24