Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364KXM9

Protein Details
Accession A0A364KXM9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-31RCADYLPSRRRLKRGPRTSNSKATKQHydrophilic
NLS Segment(s)
PositionSequence
15-20RRLKRG
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MPDCLRCADYLPSRRRLKRGPRTSNSKATKQLQPPTSSDNTADSQCLSSHGTTLLVNSPVTLSISAAAGGIVPSVVAENDCNLGLLVESTPKPRIKMRMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.73
4 0.75
5 0.77
6 0.81
7 0.82
8 0.81
9 0.85
10 0.85
11 0.85
12 0.8
13 0.75
14 0.72
15 0.66
16 0.66
17 0.63
18 0.64
19 0.59
20 0.56
21 0.52
22 0.5
23 0.47
24 0.4
25 0.33
26 0.28
27 0.25
28 0.22
29 0.2
30 0.15
31 0.13
32 0.12
33 0.13
34 0.11
35 0.09
36 0.09
37 0.09
38 0.09
39 0.08
40 0.09
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.07
47 0.08
48 0.07
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.02
61 0.03
62 0.03
63 0.04
64 0.04
65 0.05
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.07
73 0.07
74 0.1
75 0.11
76 0.14
77 0.2
78 0.23
79 0.26
80 0.32