Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364L3Y0

Protein Details
Accession A0A364L3Y0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
105-129MATAIQHQRKMRRRRGSLRKTALLGHydrophilic
NLS Segment(s)
PositionSequence
113-124RKMRRRRGSLRK
Subcellular Location(s) plas 17, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029164  PIG-Y  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF15159  PIG-Y  
Amino Acid Sequences MENGEYLSPQTVINTTQSDGQHATGRARSNSTNSGHKRSVSGSLLSKLSFLRMSQSTSTDNNEPLSSRTHGDETAGNLSPKDGHNPSNNDGYIGGSRAGGTSRAMATAIQHQRKMRRRRGSLRKTALLGTRLEMKEKRNNNNAASTARDPVNYGSIENSRGVSPSPLSISAGTDGSRTTPPPSTTLTDEDLTPRGSMDHDGGGHASVHSGYWPRSLTMDRGVVSTEIKSPTSIGDTTDEEDNISLSDFNNTTPNNNNNNTTSNGRTASTHARPSSVSSSGSIXPPLTATPSSSSGSYFVSSHHHLHHHHKTSSANEPIDATARSLGRSPTTHRARSPLIAPELSSNVSNTLDPSVGVGTSGGWDYSETEWWGWIILLVTWLVFVVGIGSSFGVWSWAWDVGETPYAPPELEDDPTLPIVGYYPALMVLTAVMAWVWVVVAWVGMKYFKHANIAADDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.23
4 0.23
5 0.26
6 0.26
7 0.26
8 0.29
9 0.28
10 0.32
11 0.31
12 0.36
13 0.35
14 0.37
15 0.39
16 0.38
17 0.44
18 0.44
19 0.49
20 0.5
21 0.56
22 0.55
23 0.53
24 0.5
25 0.45
26 0.49
27 0.41
28 0.4
29 0.36
30 0.36
31 0.37
32 0.34
33 0.33
34 0.26
35 0.25
36 0.21
37 0.17
38 0.19
39 0.2
40 0.24
41 0.25
42 0.28
43 0.29
44 0.3
45 0.34
46 0.32
47 0.31
48 0.29
49 0.28
50 0.26
51 0.23
52 0.25
53 0.22
54 0.21
55 0.22
56 0.22
57 0.22
58 0.22
59 0.23
60 0.22
61 0.25
62 0.25
63 0.23
64 0.2
65 0.21
66 0.22
67 0.21
68 0.24
69 0.22
70 0.25
71 0.33
72 0.38
73 0.41
74 0.45
75 0.44
76 0.38
77 0.35
78 0.32
79 0.25
80 0.21
81 0.18
82 0.11
83 0.11
84 0.1
85 0.11
86 0.1
87 0.09
88 0.1
89 0.1
90 0.1
91 0.1
92 0.1
93 0.11
94 0.2
95 0.28
96 0.3
97 0.34
98 0.38
99 0.48
100 0.58
101 0.67
102 0.67
103 0.68
104 0.74
105 0.81
106 0.88
107 0.89
108 0.9
109 0.87
110 0.81
111 0.73
112 0.67
113 0.61
114 0.52
115 0.43
116 0.33
117 0.34
118 0.3
119 0.32
120 0.31
121 0.33
122 0.39
123 0.46
124 0.52
125 0.52
126 0.57
127 0.55
128 0.56
129 0.53
130 0.46
131 0.43
132 0.37
133 0.32
134 0.27
135 0.24
136 0.21
137 0.19
138 0.21
139 0.16
140 0.15
141 0.14
142 0.15
143 0.16
144 0.16
145 0.15
146 0.12
147 0.12
148 0.13
149 0.11
150 0.1
151 0.1
152 0.11
153 0.11
154 0.11
155 0.11
156 0.11
157 0.11
158 0.11
159 0.1
160 0.09
161 0.08
162 0.1
163 0.1
164 0.1
165 0.12
166 0.15
167 0.16
168 0.18
169 0.21
170 0.21
171 0.22
172 0.24
173 0.24
174 0.21
175 0.21
176 0.2
177 0.18
178 0.17
179 0.14
180 0.11
181 0.09
182 0.09
183 0.1
184 0.09
185 0.09
186 0.08
187 0.08
188 0.09
189 0.09
190 0.08
191 0.07
192 0.06
193 0.05
194 0.04
195 0.05
196 0.07
197 0.07
198 0.09
199 0.1
200 0.1
201 0.12
202 0.13
203 0.13
204 0.15
205 0.17
206 0.15
207 0.15
208 0.15
209 0.14
210 0.13
211 0.12
212 0.11
213 0.1
214 0.1
215 0.1
216 0.1
217 0.1
218 0.11
219 0.11
220 0.09
221 0.1
222 0.11
223 0.12
224 0.12
225 0.12
226 0.1
227 0.09
228 0.08
229 0.06
230 0.06
231 0.05
232 0.04
233 0.06
234 0.06
235 0.07
236 0.11
237 0.11
238 0.12
239 0.17
240 0.23
241 0.27
242 0.29
243 0.3
244 0.29
245 0.31
246 0.32
247 0.3
248 0.26
249 0.23
250 0.22
251 0.2
252 0.19
253 0.2
254 0.25
255 0.26
256 0.29
257 0.27
258 0.27
259 0.27
260 0.3
261 0.3
262 0.24
263 0.21
264 0.17
265 0.19
266 0.19
267 0.2
268 0.17
269 0.13
270 0.12
271 0.11
272 0.12
273 0.1
274 0.09
275 0.1
276 0.13
277 0.14
278 0.14
279 0.14
280 0.13
281 0.14
282 0.14
283 0.12
284 0.1
285 0.14
286 0.17
287 0.19
288 0.21
289 0.24
290 0.26
291 0.35
292 0.44
293 0.47
294 0.45
295 0.45
296 0.46
297 0.46
298 0.49
299 0.47
300 0.37
301 0.3
302 0.3
303 0.28
304 0.27
305 0.23
306 0.16
307 0.13
308 0.13
309 0.14
310 0.15
311 0.15
312 0.16
313 0.18
314 0.23
315 0.3
316 0.37
317 0.41
318 0.41
319 0.45
320 0.45
321 0.46
322 0.44
323 0.4
324 0.36
325 0.32
326 0.31
327 0.28
328 0.27
329 0.25
330 0.21
331 0.15
332 0.13
333 0.13
334 0.13
335 0.12
336 0.11
337 0.1
338 0.1
339 0.1
340 0.09
341 0.08
342 0.08
343 0.07
344 0.05
345 0.06
346 0.07
347 0.06
348 0.05
349 0.06
350 0.08
351 0.09
352 0.11
353 0.12
354 0.12
355 0.12
356 0.12
357 0.12
358 0.1
359 0.09
360 0.07
361 0.06
362 0.07
363 0.06
364 0.06
365 0.06
366 0.06
367 0.05
368 0.04
369 0.04
370 0.03
371 0.04
372 0.04
373 0.04
374 0.04
375 0.04
376 0.04
377 0.05
378 0.06
379 0.05
380 0.07
381 0.08
382 0.1
383 0.11
384 0.11
385 0.12
386 0.12
387 0.16
388 0.15
389 0.14
390 0.14
391 0.14
392 0.14
393 0.13
394 0.15
395 0.14
396 0.15
397 0.16
398 0.15
399 0.17
400 0.17
401 0.17
402 0.14
403 0.11
404 0.1
405 0.1
406 0.1
407 0.08
408 0.07
409 0.08
410 0.08
411 0.08
412 0.07
413 0.05
414 0.05
415 0.05
416 0.04
417 0.04
418 0.03
419 0.03
420 0.03
421 0.03
422 0.03
423 0.03
424 0.03
425 0.04
426 0.05
427 0.06
428 0.07
429 0.09
430 0.1
431 0.14
432 0.19
433 0.2
434 0.26
435 0.28
436 0.31