Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364L6I0

Protein Details
Accession A0A364L6I0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-29GSYLSLPKRQQPSHREKRQRSPEVDDNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGSYLSLPKRQQPSHREKRQRSPEVDDNNDITTTASNTPKRQCVEKSPLLNYEDLCANVGHAARTMNKYLKRKSKEYYWLRARTDHLVQTDEEHEAILKKEKELNELVHKMREVLEVLTDLLEENKPSTLRGLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.82
3 0.85
4 0.85
5 0.89
6 0.91
7 0.9
8 0.84
9 0.82
10 0.8
11 0.78
12 0.74
13 0.67
14 0.57
15 0.49
16 0.43
17 0.34
18 0.26
19 0.17
20 0.15
21 0.15
22 0.2
23 0.22
24 0.27
25 0.31
26 0.36
27 0.38
28 0.41
29 0.4
30 0.43
31 0.47
32 0.5
33 0.5
34 0.47
35 0.49
36 0.46
37 0.43
38 0.34
39 0.27
40 0.21
41 0.16
42 0.14
43 0.1
44 0.08
45 0.09
46 0.09
47 0.07
48 0.07
49 0.08
50 0.09
51 0.11
52 0.13
53 0.17
54 0.23
55 0.29
56 0.35
57 0.44
58 0.47
59 0.5
60 0.51
61 0.54
62 0.59
63 0.6
64 0.63
65 0.63
66 0.65
67 0.62
68 0.61
69 0.55
70 0.5
71 0.46
72 0.39
73 0.32
74 0.26
75 0.25
76 0.24
77 0.23
78 0.19
79 0.15
80 0.12
81 0.11
82 0.1
83 0.11
84 0.16
85 0.15
86 0.16
87 0.21
88 0.22
89 0.26
90 0.28
91 0.32
92 0.34
93 0.39
94 0.39
95 0.38
96 0.37
97 0.34
98 0.32
99 0.28
100 0.21
101 0.16
102 0.15
103 0.13
104 0.13
105 0.12
106 0.11
107 0.09
108 0.1
109 0.1
110 0.1
111 0.1
112 0.13
113 0.13
114 0.14