Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CSS6

Protein Details
Accession A1CSS6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
147-171GEPVAESKRQKKMEKRGGQRMQYRSHydrophilic
NLS Segment(s)
PositionSequence
157-161KKMEK
Subcellular Location(s) mito 21, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008506  SND2/TMEM208  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
KEGG act:ACLA_080470  -  
Pfam View protein in Pfam  
PF05620  TMEM208_SND2  
Amino Acid Sequences MAQKAAKTLAARNTSLLLRTHLITLGLHTTFLLLHWLFNRPRSLTPYFVFACPTLAIEFYLERLGRPSYNPADGSLRSPGEDLGASGLTEYMWDVLYWTWGCMGAACLFGDRAWWLWVVIPVYSVWLAYSTFTGMRSGLAGMGGGTGEPVAESKRQKKMEKRGGQRMQYRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.29
4 0.24
5 0.21
6 0.21
7 0.21
8 0.18
9 0.18
10 0.15
11 0.16
12 0.16
13 0.14
14 0.13
15 0.12
16 0.11
17 0.1
18 0.1
19 0.13
20 0.09
21 0.11
22 0.12
23 0.19
24 0.2
25 0.24
26 0.28
27 0.26
28 0.28
29 0.33
30 0.35
31 0.34
32 0.33
33 0.35
34 0.33
35 0.31
36 0.29
37 0.23
38 0.21
39 0.16
40 0.16
41 0.11
42 0.1
43 0.09
44 0.08
45 0.08
46 0.08
47 0.1
48 0.09
49 0.09
50 0.11
51 0.12
52 0.12
53 0.13
54 0.18
55 0.17
56 0.2
57 0.2
58 0.2
59 0.21
60 0.21
61 0.22
62 0.19
63 0.17
64 0.15
65 0.15
66 0.13
67 0.1
68 0.1
69 0.08
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.08
104 0.1
105 0.1
106 0.1
107 0.09
108 0.08
109 0.09
110 0.09
111 0.08
112 0.06
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.09
120 0.09
121 0.09
122 0.09
123 0.09
124 0.09
125 0.07
126 0.07
127 0.06
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.03
134 0.03
135 0.03
136 0.04
137 0.06
138 0.12
139 0.2
140 0.27
141 0.37
142 0.45
143 0.54
144 0.64
145 0.73
146 0.79
147 0.82
148 0.84
149 0.86
150 0.88
151 0.88