Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A364L4K7

Protein Details
Accession A0A364L4K7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-48AAKSHIPIVKKRTKRFFRHQSDTFKCVPASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
36-36K
41-45RVRRR
Subcellular Location(s) mito 17.5, mito_nucl 11, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAKSHIPIVKKRTKRFFRHQSDTFKCVPASWRKPKGIDNRVRRRFKGTIAMPSIGYGSNKKXRHLMPSGHKAFLVHNTKDVELLLMHNRTYAAEIASAVSSRKRVDILAKAKALGVKVTNAKARVTTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.82
3 0.86
4 0.87
5 0.87
6 0.88
7 0.86
8 0.86
9 0.82
10 0.78
11 0.69
12 0.61
13 0.51
14 0.42
15 0.42
16 0.41
17 0.45
18 0.5
19 0.55
20 0.56
21 0.6
22 0.66
23 0.7
24 0.7
25 0.7
26 0.7
27 0.73
28 0.8
29 0.82
30 0.76
31 0.73
32 0.65
33 0.59
34 0.57
35 0.49
36 0.47
37 0.44
38 0.43
39 0.36
40 0.33
41 0.3
42 0.21
43 0.19
44 0.14
45 0.16
46 0.22
47 0.24
48 0.25
49 0.27
50 0.29
51 0.34
52 0.38
53 0.38
54 0.41
55 0.45
56 0.44
57 0.41
58 0.39
59 0.34
60 0.36
61 0.36
62 0.26
63 0.25
64 0.26
65 0.26
66 0.26
67 0.24
68 0.16
69 0.1
70 0.12
71 0.13
72 0.12
73 0.12
74 0.12
75 0.13
76 0.12
77 0.13
78 0.12
79 0.08
80 0.08
81 0.08
82 0.09
83 0.09
84 0.09
85 0.08
86 0.09
87 0.11
88 0.12
89 0.13
90 0.13
91 0.14
92 0.2
93 0.29
94 0.34
95 0.39
96 0.39
97 0.39
98 0.39
99 0.39
100 0.34
101 0.27
102 0.22
103 0.21
104 0.25
105 0.3
106 0.34
107 0.34
108 0.34
109 0.34