Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364KUF6

Protein Details
Accession A0A364KUF6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
96-132AASKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKDBasic
NLS Segment(s)
PositionSequence
99-133SKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD
Subcellular Location(s) mito 16, cyto 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPITLRTRKFIRNPLLARKQMVVDVLHPNRANVKKDELREKLXDLYKANKDQVSVFGFRTQFGGGKSTGFALVYDSHEALKKFEPHYRLVRIGAASKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.67
4 0.72
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.31
17 0.3
18 0.29
19 0.35
20 0.39
21 0.39
22 0.32
23 0.39
24 0.39
25 0.44
26 0.53
27 0.49
28 0.49
29 0.48
30 0.47
31 0.43
32 0.42
33 0.42
34 0.36
35 0.4
36 0.37
37 0.39
38 0.37
39 0.34
40 0.3
41 0.29
42 0.29
43 0.22
44 0.21
45 0.2
46 0.2
47 0.19
48 0.19
49 0.16
50 0.14
51 0.13
52 0.14
53 0.1
54 0.1
55 0.1
56 0.09
57 0.09
58 0.07
59 0.07
60 0.06
61 0.07
62 0.09
63 0.1
64 0.09
65 0.1
66 0.12
67 0.13
68 0.13
69 0.16
70 0.18
71 0.2
72 0.24
73 0.26
74 0.29
75 0.35
76 0.38
77 0.36
78 0.33
79 0.33
80 0.3
81 0.3
82 0.26
83 0.24
84 0.2
85 0.19
86 0.21
87 0.2
88 0.21
89 0.26
90 0.35
91 0.42
92 0.51
93 0.6
94 0.68
95 0.78
96 0.87
97 0.91
98 0.92
99 0.93
100 0.94
101 0.95
102 0.95
103 0.94
104 0.94
105 0.92
106 0.91
107 0.88
108 0.87
109 0.87
110 0.87
111 0.84
112 0.85