Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364L843

Protein Details
Accession A0A364L843    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
151-173GEVVISPRRKKGNKNNNNNAGDGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR028209  LAMTOR1/MEH1  
Gene Ontology GO:0031902  C:late endosome membrane  
GO:0045121  C:membrane raft  
GO:0071986  C:Ragulator complex  
GO:0071230  P:cellular response to amino acid stimulus  
GO:0042632  P:cholesterol homeostasis  
GO:0016197  P:endosomal transport  
GO:0007040  P:lysosome organization  
GO:0043410  P:positive regulation of MAPK cascade  
GO:0032008  P:positive regulation of TOR signaling  
GO:0001919  P:regulation of receptor recycling  
Pfam View protein in Pfam  
PF15454  LAMTOR  
Amino Acid Sequences MGACQSCLGLRRREDHESEHARLIDDDLYPGSYGYGSINNANAQQHDPEDLKREREALEAICQRASDTVIDIWALQSQPNFQPRATLPSTESQGSSRVPSNEIRNDDVEHNDNEQIRQGATISSRPSSSSNIGGXGGSQNQKHIAPVPNNWGEVVISPRRKKGNKNNNNNAGDGDIFGVLKVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.55
4 0.55
5 0.54
6 0.53
7 0.47
8 0.42
9 0.38
10 0.34
11 0.26
12 0.19
13 0.17
14 0.12
15 0.13
16 0.11
17 0.11
18 0.09
19 0.07
20 0.07
21 0.08
22 0.09
23 0.1
24 0.11
25 0.13
26 0.13
27 0.15
28 0.16
29 0.16
30 0.15
31 0.15
32 0.15
33 0.17
34 0.17
35 0.17
36 0.23
37 0.24
38 0.25
39 0.25
40 0.26
41 0.23
42 0.24
43 0.24
44 0.18
45 0.23
46 0.24
47 0.24
48 0.23
49 0.22
50 0.2
51 0.18
52 0.18
53 0.1
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.08
65 0.12
66 0.16
67 0.17
68 0.16
69 0.19
70 0.19
71 0.25
72 0.24
73 0.21
74 0.19
75 0.21
76 0.23
77 0.2
78 0.2
79 0.14
80 0.15
81 0.14
82 0.14
83 0.14
84 0.13
85 0.14
86 0.17
87 0.21
88 0.25
89 0.26
90 0.27
91 0.26
92 0.27
93 0.26
94 0.26
95 0.23
96 0.19
97 0.18
98 0.19
99 0.18
100 0.16
101 0.16
102 0.14
103 0.12
104 0.11
105 0.09
106 0.08
107 0.09
108 0.13
109 0.13
110 0.14
111 0.14
112 0.16
113 0.17
114 0.2
115 0.21
116 0.2
117 0.18
118 0.18
119 0.18
120 0.17
121 0.15
122 0.17
123 0.2
124 0.19
125 0.19
126 0.2
127 0.2
128 0.21
129 0.26
130 0.28
131 0.27
132 0.29
133 0.36
134 0.37
135 0.38
136 0.36
137 0.31
138 0.24
139 0.22
140 0.24
141 0.25
142 0.31
143 0.33
144 0.4
145 0.48
146 0.53
147 0.62
148 0.68
149 0.71
150 0.73
151 0.81
152 0.86
153 0.87
154 0.84
155 0.75
156 0.64
157 0.55
158 0.45
159 0.34
160 0.24
161 0.15
162 0.12