Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A364L1M3

Protein Details
Accession A0A364L1M3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-64ANIKSKAPSNNQKGKQPQKPKTSDAPAHydrophilic
72-96KLTPAEMKKKQKAEKAARRAREKLEBasic
NLS Segment(s)
PositionSequence
78-96MKKKQKAEKAARRAREKLE
Subcellular Location(s) cyto_nucl 12.5, cyto 12, nucl 9, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000649  IF-2B-related  
IPR042529  IF_2B-like_C  
IPR037171  NagB/RpiA_transferase-like  
Gene Ontology GO:0005634  C:nucleus  
GO:1901566  P:organonitrogen compound biosynthetic process  
Pfam View protein in Pfam  
PF01008  IF-2B  
Amino Acid Sequences MSSPGQSQAPPATAPQNPPATAANGASQPPTEDAQNGANIKSKAPSNNQKGKQPQKPKTSDAPAAADGSSEKLTPAEMKKKQKAEKAARRAREKLEREVGGAGPSGAQQAATQGGPVQTPRKPQQGGRDGPVPTPRGLKYPGGPRAAVPAPTETKKKEDKNVAVFGHLYGIPRRSTIAGAAKEVXPAVLALGLQIRDYVICGSSARCVATLIAFKRVIESYTTPIGTSLARHLTTHLSHQITYLSTCRPLSISQGNAIRALKLSISSIDPSVPEATAKAELCEFINNFIREKITVADQVIAASATQKIQDGDVIVTFAGSSIVKQTLITAHKQGKKFRVSIVDSRPLFEGKNLARALSSAGLEVQYSLIHGISHAMKDATKVFLGAHAMTGNGRLYSRVGTALVAMSAKERSGGAEIPVIVCCETIKFTDRVALDSIVVNEIADADELVTTQPLQQVTGRPDPHKTVDEKPGKKGGNTQSVNDGLASLTLDQNAPSPLSGWKDTPNLQLLNIMHDVTPAEYVDMVVTEMGSLPPSAVPIVHRMSTNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.39
4 0.37
5 0.39
6 0.38
7 0.35
8 0.33
9 0.3
10 0.25
11 0.22
12 0.23
13 0.22
14 0.2
15 0.19
16 0.19
17 0.19
18 0.17
19 0.16
20 0.17
21 0.19
22 0.24
23 0.24
24 0.23
25 0.28
26 0.27
27 0.27
28 0.29
29 0.31
30 0.32
31 0.4
32 0.5
33 0.54
34 0.64
35 0.68
36 0.73
37 0.79
38 0.82
39 0.83
40 0.83
41 0.83
42 0.83
43 0.84
44 0.82
45 0.81
46 0.78
47 0.74
48 0.67
49 0.62
50 0.53
51 0.48
52 0.41
53 0.32
54 0.24
55 0.21
56 0.17
57 0.13
58 0.11
59 0.09
60 0.11
61 0.16
62 0.24
63 0.31
64 0.39
65 0.49
66 0.57
67 0.66
68 0.73
69 0.75
70 0.78
71 0.79
72 0.82
73 0.83
74 0.84
75 0.83
76 0.83
77 0.82
78 0.79
79 0.78
80 0.73
81 0.7
82 0.69
83 0.61
84 0.55
85 0.51
86 0.43
87 0.34
88 0.29
89 0.2
90 0.12
91 0.11
92 0.1
93 0.08
94 0.07
95 0.06
96 0.07
97 0.09
98 0.08
99 0.08
100 0.09
101 0.1
102 0.11
103 0.14
104 0.17
105 0.18
106 0.26
107 0.32
108 0.39
109 0.41
110 0.45
111 0.53
112 0.58
113 0.59
114 0.55
115 0.56
116 0.49
117 0.49
118 0.51
119 0.42
120 0.34
121 0.34
122 0.31
123 0.29
124 0.31
125 0.31
126 0.31
127 0.38
128 0.43
129 0.41
130 0.41
131 0.37
132 0.4
133 0.39
134 0.35
135 0.27
136 0.24
137 0.26
138 0.29
139 0.34
140 0.29
141 0.34
142 0.41
143 0.45
144 0.48
145 0.53
146 0.57
147 0.59
148 0.64
149 0.58
150 0.51
151 0.46
152 0.38
153 0.31
154 0.24
155 0.19
156 0.14
157 0.16
158 0.15
159 0.15
160 0.16
161 0.14
162 0.14
163 0.17
164 0.22
165 0.21
166 0.23
167 0.24
168 0.23
169 0.22
170 0.21
171 0.16
172 0.09
173 0.08
174 0.05
175 0.04
176 0.04
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.06
185 0.05
186 0.05
187 0.06
188 0.07
189 0.08
190 0.09
191 0.09
192 0.09
193 0.09
194 0.08
195 0.1
196 0.15
197 0.14
198 0.18
199 0.18
200 0.18
201 0.2
202 0.2
203 0.18
204 0.16
205 0.16
206 0.15
207 0.17
208 0.17
209 0.15
210 0.15
211 0.15
212 0.13
213 0.12
214 0.12
215 0.12
216 0.13
217 0.13
218 0.14
219 0.16
220 0.17
221 0.19
222 0.22
223 0.2
224 0.19
225 0.2
226 0.19
227 0.17
228 0.17
229 0.16
230 0.11
231 0.12
232 0.12
233 0.12
234 0.12
235 0.12
236 0.15
237 0.17
238 0.17
239 0.19
240 0.22
241 0.22
242 0.23
243 0.23
244 0.18
245 0.15
246 0.14
247 0.1
248 0.08
249 0.08
250 0.06
251 0.07
252 0.08
253 0.08
254 0.08
255 0.08
256 0.09
257 0.09
258 0.08
259 0.07
260 0.06
261 0.07
262 0.09
263 0.09
264 0.08
265 0.08
266 0.08
267 0.09
268 0.1
269 0.09
270 0.1
271 0.15
272 0.16
273 0.16
274 0.16
275 0.16
276 0.14
277 0.15
278 0.13
279 0.1
280 0.11
281 0.11
282 0.11
283 0.1
284 0.1
285 0.09
286 0.08
287 0.06
288 0.05
289 0.05
290 0.05
291 0.05
292 0.06
293 0.06
294 0.06
295 0.07
296 0.07
297 0.07
298 0.07
299 0.07
300 0.06
301 0.05
302 0.05
303 0.04
304 0.04
305 0.04
306 0.04
307 0.05
308 0.06
309 0.06
310 0.06
311 0.07
312 0.12
313 0.14
314 0.16
315 0.2
316 0.27
317 0.33
318 0.37
319 0.42
320 0.45
321 0.48
322 0.48
323 0.46
324 0.46
325 0.45
326 0.49
327 0.5
328 0.51
329 0.46
330 0.45
331 0.42
332 0.35
333 0.31
334 0.24
335 0.24
336 0.16
337 0.23
338 0.22
339 0.21
340 0.2
341 0.2
342 0.21
343 0.16
344 0.15
345 0.08
346 0.08
347 0.08
348 0.08
349 0.08
350 0.07
351 0.05
352 0.05
353 0.05
354 0.05
355 0.04
356 0.04
357 0.07
358 0.08
359 0.08
360 0.09
361 0.09
362 0.09
363 0.11
364 0.12
365 0.12
366 0.1
367 0.11
368 0.1
369 0.11
370 0.13
371 0.12
372 0.11
373 0.09
374 0.09
375 0.09
376 0.11
377 0.09
378 0.08
379 0.08
380 0.08
381 0.09
382 0.1
383 0.11
384 0.1
385 0.1
386 0.09
387 0.1
388 0.09
389 0.09
390 0.08
391 0.07
392 0.07
393 0.08
394 0.07
395 0.08
396 0.07
397 0.08
398 0.1
399 0.11
400 0.11
401 0.13
402 0.13
403 0.13
404 0.14
405 0.13
406 0.11
407 0.1
408 0.09
409 0.07
410 0.09
411 0.1
412 0.13
413 0.14
414 0.14
415 0.2
416 0.2
417 0.21
418 0.22
419 0.21
420 0.18
421 0.18
422 0.19
423 0.14
424 0.13
425 0.11
426 0.08
427 0.08
428 0.07
429 0.06
430 0.05
431 0.04
432 0.04
433 0.05
434 0.05
435 0.05
436 0.05
437 0.07
438 0.1
439 0.1
440 0.11
441 0.14
442 0.19
443 0.25
444 0.33
445 0.37
446 0.36
447 0.4
448 0.44
449 0.46
450 0.46
451 0.44
452 0.43
453 0.49
454 0.57
455 0.56
456 0.57
457 0.61
458 0.58
459 0.55
460 0.57
461 0.56
462 0.56
463 0.54
464 0.5
465 0.48
466 0.47
467 0.46
468 0.37
469 0.28
470 0.17
471 0.15
472 0.14
473 0.09
474 0.09
475 0.09
476 0.09
477 0.09
478 0.11
479 0.12
480 0.12
481 0.11
482 0.11
483 0.14
484 0.19
485 0.21
486 0.22
487 0.25
488 0.3
489 0.34
490 0.38
491 0.4
492 0.36
493 0.34
494 0.37
495 0.33
496 0.32
497 0.31
498 0.26
499 0.2
500 0.19
501 0.2
502 0.15
503 0.16
504 0.11
505 0.1
506 0.09
507 0.09
508 0.09
509 0.08
510 0.08
511 0.06
512 0.06
513 0.06
514 0.06
515 0.06
516 0.07
517 0.07
518 0.07
519 0.07
520 0.08
521 0.09
522 0.09
523 0.11
524 0.16
525 0.2
526 0.22