Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364KP04

Protein Details
Accession A0A364KP04    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-82DHDHEIKKAKRKRPSPNAYERQPRNERRPTQQPKAABasic
NLS Segment(s)
PositionSequence
53-71KKAKRKRPSPNAYERQPRN
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDESSSESESSSSSDDSDTDDDSDMRARRRPVRREGCGHDGHDLEHDHDHEIKKAKRKRPSPNAYERQPRNERRPTQQPKAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.14
4 0.15
5 0.14
6 0.13
7 0.14
8 0.13
9 0.13
10 0.18
11 0.17
12 0.18
13 0.22
14 0.26
15 0.34
16 0.43
17 0.5
18 0.56
19 0.62
20 0.66
21 0.68
22 0.69
23 0.67
24 0.6
25 0.54
26 0.46
27 0.37
28 0.31
29 0.26
30 0.2
31 0.15
32 0.13
33 0.13
34 0.11
35 0.14
36 0.15
37 0.16
38 0.23
39 0.26
40 0.35
41 0.43
42 0.5
43 0.56
44 0.65
45 0.73
46 0.76
47 0.82
48 0.82
49 0.85
50 0.86
51 0.85
52 0.86
53 0.8
54 0.79
55 0.79
56 0.78
57 0.77
58 0.78
59 0.77
60 0.75
61 0.81
62 0.81
63 0.81