FuNGI

A1C757

Protein Details

Accession

A1C757

Localization Confidence

High

Confidence Score

15.3

NoLS Segment(s)

Position	Sequence	Protein Nature
50-77	QPAEEEEKAKKKRPSKKRPAEGLHEPAA	Basic
252-275	LTPPLRYVRKRRFRERLRTRTIEQ	Hydrophilic

NLS Segment(s)

Position	Sequence
40-105	KITLKIARKPQPAEEEEKAKKKRPSKKRPAEGLHEPAAVEPSVKPAGPKRLKLNPSKKPGVQSIRI

Subcellular Location(s)

nucl 19.5, cyto_nucl 12.5, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR037817 TAF7 IPR006751 TAFII55_prot_cons_reg
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0003743 F:translation initiation factor activity GO:0006367 P:transcription initiation at RNA polymerase II promoter
KEGG	act:ACLA_072610 -
Pfam	View protein in Pfam PF04658 TAFII55_N
CDD	cd08047 TAF7

Amino Acid Sequences

MSDAPRPSLKLTLGKKKAPETSSQPPAQPPPPSSETPQRKITLKIARKPQPAEEEEKAKKKRPSKKRPAEGLHEPAAVEPSVKPAGPKRLKLNPSKKPGVQSIRIKNKGLVPNRPVGVGYDSEASDTEIDPCIEEQFILRMLPGEDCEYLRQAITERRFDRSEFSFKPLTREGRRAILRVRDKQYAATLVDLPCIIEGMKSWDRRGWYKSADICQMLLVLGPVANDAEAMNYPLPSDVNLLDDKTLQYPHGLTPPLRYVRKRRFRERLRTRTIEQVEKAVEDLIAQDEAALASRYELLDRASLNRAEGLVQSGEYYEDYDEYDDEQDAEGELDEGMEDIAGDHEGLDPLLEDLEAALRGDEAPPAMAPPSDTGLAHLYQAGTPMATKPSTPAADTSGDESESDADEADVPEEELDEEQLEQQRQVQQHREEIAELEALIRAETVKWEKMQNAILKHKLAKRIQDLKRDLSLKKVSVGEGGDADT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.64
3	0.66
4	0.7
5	0.64
6	0.62
7	0.6
8	0.62
9	0.65
10	0.63
11	0.59
12	0.56
13	0.6
14	0.58
15	0.56
16	0.49
17	0.48
18	0.49
19	0.5
20	0.51
21	0.55
22	0.58
23	0.58
24	0.63
25	0.6
26	0.58
27	0.59
28	0.62
29	0.62
30	0.62
31	0.64
32	0.67
33	0.72
34	0.76
35	0.75
36	0.73
37	0.71
38	0.67
39	0.66
40	0.61
41	0.62
42	0.62
43	0.68
44	0.66
45	0.65
46	0.69
47	0.7
48	0.75
49	0.77
50	0.8
51	0.82
52	0.87
53	0.9
54	0.92
55	0.91
56	0.89
57	0.86
58	0.81
59	0.74
60	0.63
61	0.53
62	0.42
63	0.36
64	0.28
65	0.2
66	0.13
67	0.14
68	0.15
69	0.15
70	0.17
71	0.21
72	0.32
73	0.38
74	0.44
75	0.47
76	0.55
77	0.63
78	0.71
79	0.76
80	0.74
81	0.76
82	0.78
83	0.74
84	0.7
85	0.71
86	0.68
87	0.67
88	0.67
89	0.69
90	0.72
91	0.73
92	0.69
93	0.63
94	0.63
95	0.63
96	0.6
97	0.58
98	0.51
99	0.53
100	0.52
101	0.49
102	0.41
103	0.34
104	0.3
105	0.22
106	0.19
107	0.14
108	0.14
109	0.14
110	0.14
111	0.13
112	0.11
113	0.1
114	0.1
115	0.09
116	0.1
117	0.1
118	0.1
119	0.1
120	0.09
121	0.09
122	0.07
123	0.07
124	0.08
125	0.08
126	0.07
127	0.08
128	0.08
129	0.09
130	0.1
131	0.11
132	0.11
133	0.12
134	0.13
135	0.13
136	0.13
137	0.12
138	0.12
139	0.12
140	0.18
141	0.22
142	0.3
143	0.3
144	0.34
145	0.36
146	0.36
147	0.38
148	0.36
149	0.39
150	0.33
151	0.36
152	0.38
153	0.37
154	0.41
155	0.42
156	0.45
157	0.41
158	0.45
159	0.42
160	0.44
161	0.46
162	0.44
163	0.43
164	0.44
165	0.48
166	0.5
167	0.53
168	0.49
169	0.48
170	0.46
171	0.44
172	0.38
173	0.3
174	0.23
175	0.22
176	0.17
177	0.17
178	0.15
179	0.13
180	0.09
181	0.09
182	0.07
183	0.04
184	0.04
185	0.11
186	0.17
187	0.18
188	0.19
189	0.21
190	0.23
191	0.27
192	0.31
193	0.28
194	0.25
195	0.3
196	0.33
197	0.35
198	0.35
199	0.32
200	0.28
201	0.24
202	0.21
203	0.15
204	0.11
205	0.07
206	0.04
207	0.04
208	0.04
209	0.04
210	0.03
211	0.03
212	0.03
213	0.03
214	0.04
215	0.04
216	0.05
217	0.05
218	0.05
219	0.05
220	0.05
221	0.06
222	0.05
223	0.07
224	0.06
225	0.07
226	0.08
227	0.08
228	0.08
229	0.09
230	0.09
231	0.09
232	0.09
233	0.07
234	0.08
235	0.08
236	0.09
237	0.12
238	0.13
239	0.12
240	0.14
241	0.2
242	0.26
243	0.28
244	0.32
245	0.38
246	0.48
247	0.58
248	0.63
249	0.67
250	0.72
251	0.78
252	0.86
253	0.87
254	0.87
255	0.85
256	0.82
257	0.74
258	0.72
259	0.66
260	0.6
261	0.49
262	0.42
263	0.34
264	0.29
265	0.27
266	0.18
267	0.14
268	0.08
269	0.08
270	0.06
271	0.05
272	0.05
273	0.04
274	0.04
275	0.04
276	0.05
277	0.05
278	0.04
279	0.04
280	0.05
281	0.05
282	0.06
283	0.06
284	0.07
285	0.08
286	0.09
287	0.11
288	0.14
289	0.14
290	0.14
291	0.14
292	0.13
293	0.12
294	0.12
295	0.11
296	0.08
297	0.08
298	0.08
299	0.07
300	0.08
301	0.07
302	0.08
303	0.06
304	0.06
305	0.06
306	0.07
307	0.07
308	0.08
309	0.08
310	0.08
311	0.08
312	0.07
313	0.07
314	0.07
315	0.07
316	0.05
317	0.05
318	0.05
319	0.04
320	0.04
321	0.04
322	0.03
323	0.03
324	0.03
325	0.02
326	0.03
327	0.03
328	0.03
329	0.04
330	0.04
331	0.05
332	0.04
333	0.04
334	0.04
335	0.04
336	0.04
337	0.04
338	0.03
339	0.03
340	0.04
341	0.05
342	0.04
343	0.04
344	0.04
345	0.05
346	0.06
347	0.06
348	0.05
349	0.06
350	0.06
351	0.06
352	0.07
353	0.07
354	0.07
355	0.08
356	0.1
357	0.11
358	0.11
359	0.12
360	0.14
361	0.14
362	0.14
363	0.13
364	0.11
365	0.1
366	0.12
367	0.1
368	0.08
369	0.08
370	0.1
371	0.12
372	0.12
373	0.12
374	0.12
375	0.19
376	0.2
377	0.2
378	0.2
379	0.2
380	0.23
381	0.23
382	0.24
383	0.19
384	0.18
385	0.17
386	0.16
387	0.14
388	0.13
389	0.12
390	0.09
391	0.08
392	0.08
393	0.09
394	0.09
395	0.08
396	0.07
397	0.07
398	0.07
399	0.07
400	0.07
401	0.07
402	0.07
403	0.07
404	0.1
405	0.15
406	0.16
407	0.16
408	0.2
409	0.25
410	0.29
411	0.35
412	0.41
413	0.4
414	0.46
415	0.49
416	0.46
417	0.42
418	0.38
419	0.33
420	0.25
421	0.2
422	0.14
423	0.13
424	0.11
425	0.1
426	0.09
427	0.07
428	0.07
429	0.13
430	0.17
431	0.2
432	0.23
433	0.27
434	0.28
435	0.33
436	0.39
437	0.4
438	0.43
439	0.48
440	0.5
441	0.52
442	0.58
443	0.59
444	0.61
445	0.61
446	0.62
447	0.64
448	0.69
449	0.72
450	0.75
451	0.75
452	0.72
453	0.74
454	0.71
455	0.62
456	0.61
457	0.6
458	0.52
459	0.51
460	0.48
461	0.4
462	0.39
463	0.39
464	0.32

A1C757

3D AlphaFold-predicted Structure Viewer