Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A364KX18

Protein Details
Accession A0A364KX18    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-54LSHQCTKPASPEKKERRRKQVLQAQRAYRAHydrophilic
NLS Segment(s)
PositionSequence
37-43KKERRRK
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MMSGVQPTASAPQPPSETSSKTTGLSHQCTKPASPEKKERRRKQVLQAQRAYRARNEANITALKQRVAHLESALERMGKAVVDLSDILAEKRVLTSHPNIADRLRDTLKTCLDSAKYGKERHEDFGHSQPNDTSLRVQRPVDKQSSPKYDPKESPLPINSTRRSAQPHNRFLPFELDGAASPERFSEIPFFKLGGTGTHYRGALVSNQNKSGLEEQHFPVVHSALSAFPPEAQEELDGEWFDLWDLVGYLRAETITLSLEPPNEETTHRTVNVVDFTAALVEKGICLGYSPGFKRSDVETAITLSSWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.31
4 0.33
5 0.33
6 0.37
7 0.34
8 0.33
9 0.33
10 0.36
11 0.39
12 0.42
13 0.46
14 0.45
15 0.48
16 0.48
17 0.48
18 0.5
19 0.52
20 0.54
21 0.56
22 0.63
23 0.69
24 0.78
25 0.88
26 0.88
27 0.89
28 0.9
29 0.9
30 0.9
31 0.89
32 0.89
33 0.89
34 0.87
35 0.81
36 0.8
37 0.76
38 0.68
39 0.61
40 0.58
41 0.5
42 0.47
43 0.47
44 0.38
45 0.39
46 0.38
47 0.37
48 0.34
49 0.33
50 0.28
51 0.25
52 0.25
53 0.26
54 0.25
55 0.24
56 0.19
57 0.21
58 0.21
59 0.22
60 0.21
61 0.16
62 0.13
63 0.13
64 0.12
65 0.09
66 0.08
67 0.07
68 0.06
69 0.08
70 0.08
71 0.07
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.08
79 0.09
80 0.08
81 0.12
82 0.16
83 0.2
84 0.24
85 0.25
86 0.26
87 0.27
88 0.29
89 0.26
90 0.28
91 0.24
92 0.22
93 0.23
94 0.27
95 0.28
96 0.27
97 0.26
98 0.24
99 0.23
100 0.24
101 0.24
102 0.28
103 0.31
104 0.31
105 0.34
106 0.37
107 0.38
108 0.39
109 0.4
110 0.35
111 0.33
112 0.39
113 0.41
114 0.35
115 0.34
116 0.29
117 0.29
118 0.27
119 0.24
120 0.2
121 0.18
122 0.22
123 0.25
124 0.26
125 0.29
126 0.33
127 0.38
128 0.38
129 0.36
130 0.37
131 0.42
132 0.48
133 0.46
134 0.46
135 0.46
136 0.47
137 0.46
138 0.47
139 0.47
140 0.4
141 0.4
142 0.36
143 0.36
144 0.36
145 0.41
146 0.36
147 0.33
148 0.33
149 0.32
150 0.35
151 0.38
152 0.43
153 0.46
154 0.53
155 0.54
156 0.55
157 0.53
158 0.49
159 0.45
160 0.36
161 0.27
162 0.19
163 0.15
164 0.13
165 0.15
166 0.14
167 0.09
168 0.08
169 0.08
170 0.09
171 0.08
172 0.09
173 0.12
174 0.14
175 0.16
176 0.16
177 0.17
178 0.15
179 0.16
180 0.16
181 0.11
182 0.14
183 0.15
184 0.16
185 0.18
186 0.18
187 0.17
188 0.17
189 0.17
190 0.18
191 0.23
192 0.27
193 0.27
194 0.29
195 0.29
196 0.29
197 0.3
198 0.29
199 0.25
200 0.22
201 0.24
202 0.24
203 0.29
204 0.29
205 0.27
206 0.24
207 0.2
208 0.17
209 0.13
210 0.13
211 0.08
212 0.09
213 0.09
214 0.08
215 0.08
216 0.09
217 0.1
218 0.1
219 0.09
220 0.09
221 0.09
222 0.1
223 0.11
224 0.1
225 0.09
226 0.09
227 0.08
228 0.07
229 0.07
230 0.05
231 0.04
232 0.04
233 0.04
234 0.07
235 0.08
236 0.08
237 0.08
238 0.08
239 0.08
240 0.08
241 0.08
242 0.07
243 0.08
244 0.09
245 0.1
246 0.11
247 0.13
248 0.15
249 0.16
250 0.16
251 0.17
252 0.2
253 0.24
254 0.28
255 0.27
256 0.26
257 0.25
258 0.27
259 0.29
260 0.26
261 0.2
262 0.15
263 0.15
264 0.16
265 0.14
266 0.11
267 0.09
268 0.07
269 0.07
270 0.07
271 0.07
272 0.05
273 0.07
274 0.09
275 0.11
276 0.19
277 0.21
278 0.26
279 0.28
280 0.28
281 0.3
282 0.32
283 0.36
284 0.31
285 0.31
286 0.27
287 0.28
288 0.28