Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CNF7

Protein Details
Accession A1CNF7   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
55-85TLPHYASSPKPKPKPKPKPKPKPPTYLPELAHydrophilic
NLS Segment(s)
PositionSequence
63-77PKPKPKPKPKPKPKP
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 7, cyto 4
Family & Domain DBs
KEGG act:ACLA_018820  -  
Amino Acid Sequences MSKYDLPGPLPPSHQHPNPSPINLNHSPHRRIHISVCSNTTSQPILPETDIHGVTLPHYASSPKPKPKPKPKPKPKPPTYLPELADVGTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.43
4 0.48
5 0.48
6 0.5
7 0.47
8 0.42
9 0.46
10 0.46
11 0.45
12 0.45
13 0.47
14 0.47
15 0.45
16 0.48
17 0.42
18 0.39
19 0.4
20 0.41
21 0.4
22 0.39
23 0.38
24 0.35
25 0.33
26 0.31
27 0.28
28 0.19
29 0.14
30 0.13
31 0.12
32 0.11
33 0.11
34 0.1
35 0.11
36 0.13
37 0.13
38 0.11
39 0.11
40 0.1
41 0.1
42 0.12
43 0.1
44 0.07
45 0.08
46 0.09
47 0.12
48 0.22
49 0.3
50 0.37
51 0.46
52 0.56
53 0.67
54 0.77
55 0.85
56 0.87
57 0.9
58 0.92
59 0.95
60 0.96
61 0.97
62 0.94
63 0.93
64 0.88
65 0.86
66 0.82
67 0.79
68 0.69
69 0.63
70 0.55