Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A364KQW9

Protein Details
Accession A0A364KQW9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
277-317AEFERREAEKKRRREVKFKQKLTDLKKRTRVEAYRRNRQGPBasic
NLS Segment(s)
PositionSequence
282-314RREAEKKRRREVKFKQKLTDLKKRTRVEAYRRN
Subcellular Location(s) nucl 16, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009061  DNA-bd_dom_put_sf  
IPR000465  XPA  
IPR022656  XPA_C  
IPR037129  XPA_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0046872  F:metal ion binding  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF05181  XPA_C  
CDD cd21077  DBD_Rad14  
Amino Acid Sequences MEXPTTPPAPAVQQGQLPRGPITPEQQRRIEINRMKAKAIREQREAESAAAAGQSTNASKVSGVKRSFNTMTSTQGPSTLRDAANNRPLESIKPARAFSKYVEYEFSKMTDTKGGFLTQEDDPHNKVLHVSDGKEQKPANMTQKEWERKLLLDDLRRNKAGPFEPGLSVLDEQASQRACRECGSLEIDWKWEEAFKCCVCNTCKDKFPEKYSMLTKTEAREDYLLTDPELKDEELLPHLKKPNPHKSTWNDMMLYLRFQVEEYAFSPKKWGSPEALDAEFERREAEKKRRREVKFKQKLTDLKKRTRVEAYRRNRQGPAGGNFGDDLGGKKKHVHEWGRQVENPETGMTVKTCFECGMEVEELEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.34
4 0.32
5 0.3
6 0.31
7 0.29
8 0.33
9 0.39
10 0.46
11 0.51
12 0.53
13 0.55
14 0.56
15 0.59
16 0.62
17 0.58
18 0.59
19 0.62
20 0.6
21 0.6
22 0.58
23 0.57
24 0.56
25 0.6
26 0.57
27 0.54
28 0.57
29 0.56
30 0.57
31 0.54
32 0.45
33 0.35
34 0.27
35 0.22
36 0.17
37 0.14
38 0.08
39 0.07
40 0.08
41 0.08
42 0.09
43 0.09
44 0.09
45 0.1
46 0.17
47 0.22
48 0.29
49 0.31
50 0.36
51 0.38
52 0.45
53 0.46
54 0.41
55 0.41
56 0.34
57 0.36
58 0.34
59 0.35
60 0.28
61 0.31
62 0.3
63 0.27
64 0.28
65 0.29
66 0.25
67 0.27
68 0.3
69 0.33
70 0.4
71 0.4
72 0.37
73 0.34
74 0.35
75 0.32
76 0.36
77 0.35
78 0.33
79 0.35
80 0.35
81 0.36
82 0.37
83 0.37
84 0.32
85 0.35
86 0.31
87 0.28
88 0.31
89 0.31
90 0.3
91 0.29
92 0.28
93 0.21
94 0.19
95 0.19
96 0.2
97 0.18
98 0.18
99 0.19
100 0.18
101 0.16
102 0.16
103 0.18
104 0.13
105 0.17
106 0.18
107 0.19
108 0.2
109 0.22
110 0.22
111 0.18
112 0.18
113 0.15
114 0.19
115 0.18
116 0.19
117 0.23
118 0.29
119 0.3
120 0.33
121 0.32
122 0.28
123 0.3
124 0.33
125 0.36
126 0.33
127 0.33
128 0.35
129 0.44
130 0.48
131 0.46
132 0.44
133 0.36
134 0.33
135 0.35
136 0.35
137 0.3
138 0.31
139 0.37
140 0.41
141 0.43
142 0.43
143 0.41
144 0.36
145 0.37
146 0.32
147 0.27
148 0.24
149 0.22
150 0.21
151 0.22
152 0.22
153 0.17
154 0.15
155 0.12
156 0.09
157 0.07
158 0.07
159 0.09
160 0.09
161 0.08
162 0.1
163 0.11
164 0.12
165 0.12
166 0.13
167 0.11
168 0.13
169 0.17
170 0.15
171 0.16
172 0.16
173 0.16
174 0.15
175 0.15
176 0.12
177 0.11
178 0.11
179 0.12
180 0.16
181 0.15
182 0.17
183 0.17
184 0.22
185 0.21
186 0.29
187 0.32
188 0.32
189 0.37
190 0.4
191 0.48
192 0.49
193 0.52
194 0.52
195 0.48
196 0.49
197 0.47
198 0.48
199 0.42
200 0.39
201 0.36
202 0.29
203 0.32
204 0.28
205 0.26
206 0.21
207 0.19
208 0.19
209 0.2
210 0.18
211 0.14
212 0.17
213 0.15
214 0.16
215 0.17
216 0.14
217 0.12
218 0.12
219 0.13
220 0.12
221 0.16
222 0.15
223 0.19
224 0.24
225 0.26
226 0.31
227 0.4
228 0.48
229 0.49
230 0.52
231 0.56
232 0.56
233 0.63
234 0.63
235 0.57
236 0.47
237 0.42
238 0.43
239 0.35
240 0.3
241 0.22
242 0.16
243 0.12
244 0.12
245 0.13
246 0.1
247 0.11
248 0.11
249 0.2
250 0.2
251 0.2
252 0.23
253 0.22
254 0.25
255 0.26
256 0.27
257 0.22
258 0.25
259 0.3
260 0.31
261 0.31
262 0.29
263 0.27
264 0.28
265 0.24
266 0.2
267 0.17
268 0.14
269 0.18
270 0.26
271 0.36
272 0.41
273 0.5
274 0.61
275 0.69
276 0.75
277 0.81
278 0.84
279 0.85
280 0.87
281 0.85
282 0.81
283 0.8
284 0.82
285 0.8
286 0.8
287 0.78
288 0.77
289 0.79
290 0.75
291 0.73
292 0.74
293 0.74
294 0.73
295 0.75
296 0.75
297 0.76
298 0.8
299 0.8
300 0.72
301 0.66
302 0.62
303 0.6
304 0.55
305 0.5
306 0.43
307 0.38
308 0.36
309 0.33
310 0.26
311 0.18
312 0.16
313 0.16
314 0.17
315 0.17
316 0.23
317 0.28
318 0.35
319 0.44
320 0.49
321 0.53
322 0.62
323 0.7
324 0.72
325 0.69
326 0.67
327 0.61
328 0.56
329 0.48
330 0.37
331 0.29
332 0.23
333 0.23
334 0.19
335 0.17
336 0.17
337 0.16
338 0.17
339 0.16
340 0.16
341 0.15
342 0.16
343 0.19
344 0.18