Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9R1I1

Protein Details
Accession A0A2U9R1I1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
13-40KLSQGVKSVKRRSRKGCLSCKRSKVKCDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.333, mito_nucl 10.999, cyto 6.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MENNDINVIMASKLSQGVKSVKRRSRKGCLSCKRSKVKCDEQHPTCGRCFRRGTECEYPVSTRSTPTETTGDSSVGVVLNQKCRVTKDMEQEDAGFVPHVRSKAAEFIRSLIDKKGCPEVKDFSQVIKSIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.15
4 0.23
5 0.32
6 0.41
7 0.5
8 0.54
9 0.63
10 0.72
11 0.76
12 0.79
13 0.81
14 0.81
15 0.82
16 0.86
17 0.85
18 0.85
19 0.86
20 0.86
21 0.81
22 0.79
23 0.77
24 0.77
25 0.77
26 0.76
27 0.77
28 0.69
29 0.73
30 0.7
31 0.63
32 0.56
33 0.54
34 0.48
35 0.45
36 0.44
37 0.38
38 0.42
39 0.42
40 0.46
41 0.47
42 0.46
43 0.42
44 0.4
45 0.38
46 0.3
47 0.32
48 0.24
49 0.17
50 0.17
51 0.18
52 0.17
53 0.18
54 0.18
55 0.15
56 0.17
57 0.16
58 0.15
59 0.12
60 0.11
61 0.09
62 0.07
63 0.07
64 0.1
65 0.1
66 0.14
67 0.16
68 0.17
69 0.18
70 0.2
71 0.23
72 0.25
73 0.3
74 0.35
75 0.39
76 0.4
77 0.4
78 0.38
79 0.36
80 0.3
81 0.24
82 0.15
83 0.09
84 0.09
85 0.11
86 0.11
87 0.11
88 0.11
89 0.13
90 0.21
91 0.24
92 0.25
93 0.23
94 0.25
95 0.3
96 0.31
97 0.31
98 0.28
99 0.29
100 0.27
101 0.3
102 0.38
103 0.37
104 0.36
105 0.4
106 0.4
107 0.41
108 0.47
109 0.45
110 0.39
111 0.4