Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A099P2H2

Protein Details
Accession A0A099P2H2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
293-312GTDKRLLVNRKKQLKMYRCWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 12, cyto_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR026113  METTL2/6/8-like  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008173  F:RNA methyltransferase activity  
Pfam View protein in Pfam  
PF13489  Methyltransf_23  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MTAKSDEGAEHMKKPALDSRIGRDLPFAFGQRFLDSEEDVFKHNAWDNVDWDAEQLEQFQLSIEKQKEEPVNEFYRNEYNSKPKKYWDIFYKNNRENFFKDRKWLEIEFPSIFECTKADSGPKTILEIGCGAGNTMYPILSKNENPELRVFGCDYSDVAVNLVRSNENFESLNAAGNAYSSVWDLANEEGKIPDDLEENSVDIAVMIFVFSALSPEQWEQGIANLKKCLKPGGIILFRDYGRYDLAQIRFKKNRLLDDNFYVRGDGTRVYFFTEEELREIFCTKGELIEEKIGTDKRLLVNRKKQLKMYRCWLQAVFKMPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.32
4 0.37
5 0.37
6 0.41
7 0.48
8 0.48
9 0.45
10 0.42
11 0.39
12 0.36
13 0.36
14 0.31
15 0.23
16 0.25
17 0.27
18 0.23
19 0.23
20 0.21
21 0.19
22 0.17
23 0.18
24 0.19
25 0.18
26 0.2
27 0.2
28 0.18
29 0.2
30 0.22
31 0.24
32 0.24
33 0.25
34 0.24
35 0.26
36 0.26
37 0.22
38 0.19
39 0.16
40 0.13
41 0.11
42 0.1
43 0.08
44 0.07
45 0.07
46 0.08
47 0.09
48 0.09
49 0.17
50 0.18
51 0.2
52 0.2
53 0.27
54 0.31
55 0.32
56 0.35
57 0.34
58 0.38
59 0.39
60 0.39
61 0.35
62 0.37
63 0.36
64 0.35
65 0.33
66 0.38
67 0.44
68 0.5
69 0.49
70 0.47
71 0.55
72 0.56
73 0.6
74 0.59
75 0.6
76 0.62
77 0.7
78 0.76
79 0.72
80 0.74
81 0.69
82 0.63
83 0.58
84 0.57
85 0.56
86 0.48
87 0.5
88 0.46
89 0.47
90 0.48
91 0.44
92 0.41
93 0.35
94 0.37
95 0.3
96 0.28
97 0.25
98 0.21
99 0.19
100 0.15
101 0.11
102 0.1
103 0.1
104 0.1
105 0.12
106 0.12
107 0.14
108 0.17
109 0.16
110 0.15
111 0.17
112 0.16
113 0.14
114 0.14
115 0.12
116 0.1
117 0.1
118 0.08
119 0.06
120 0.06
121 0.05
122 0.05
123 0.04
124 0.04
125 0.05
126 0.07
127 0.09
128 0.1
129 0.13
130 0.21
131 0.22
132 0.23
133 0.23
134 0.24
135 0.22
136 0.23
137 0.2
138 0.12
139 0.12
140 0.11
141 0.1
142 0.08
143 0.08
144 0.07
145 0.06
146 0.07
147 0.07
148 0.07
149 0.08
150 0.07
151 0.06
152 0.11
153 0.11
154 0.11
155 0.11
156 0.11
157 0.13
158 0.13
159 0.14
160 0.1
161 0.1
162 0.08
163 0.08
164 0.08
165 0.05
166 0.05
167 0.04
168 0.05
169 0.05
170 0.05
171 0.06
172 0.07
173 0.09
174 0.09
175 0.09
176 0.08
177 0.09
178 0.09
179 0.09
180 0.09
181 0.07
182 0.08
183 0.09
184 0.09
185 0.08
186 0.08
187 0.08
188 0.07
189 0.05
190 0.05
191 0.03
192 0.03
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.04
199 0.04
200 0.05
201 0.06
202 0.07
203 0.08
204 0.08
205 0.09
206 0.07
207 0.11
208 0.2
209 0.2
210 0.22
211 0.25
212 0.28
213 0.3
214 0.31
215 0.31
216 0.23
217 0.23
218 0.26
219 0.31
220 0.34
221 0.32
222 0.34
223 0.34
224 0.33
225 0.32
226 0.28
227 0.19
228 0.16
229 0.15
230 0.16
231 0.19
232 0.24
233 0.31
234 0.35
235 0.43
236 0.47
237 0.49
238 0.53
239 0.51
240 0.56
241 0.56
242 0.59
243 0.55
244 0.57
245 0.6
246 0.54
247 0.49
248 0.4
249 0.32
250 0.26
251 0.22
252 0.16
253 0.13
254 0.14
255 0.14
256 0.17
257 0.17
258 0.16
259 0.19
260 0.21
261 0.2
262 0.2
263 0.2
264 0.17
265 0.18
266 0.19
267 0.16
268 0.12
269 0.14
270 0.12
271 0.13
272 0.15
273 0.16
274 0.19
275 0.24
276 0.23
277 0.21
278 0.27
279 0.26
280 0.25
281 0.24
282 0.25
283 0.26
284 0.35
285 0.43
286 0.48
287 0.57
288 0.66
289 0.74
290 0.75
291 0.78
292 0.8
293 0.8
294 0.79
295 0.78
296 0.78
297 0.72
298 0.72
299 0.67
300 0.63
301 0.59
302 0.57