Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9RAE1

Protein Details
Accession A0A2U9RAE1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AQRVTFRRRNPYNTKSNQIKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTFRRRNPYNTKSNQIKVVKTPGGKLVAQHVKKQATRPKCGDCGIPLPGIATLRPRGYASISKTQKTVSRAYGGSRCANCVKERVVRAFLIEEQKVVKKVLKEAAAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.78
4 0.74
5 0.73
6 0.68
7 0.63
8 0.57
9 0.58
10 0.54
11 0.47
12 0.45
13 0.4
14 0.39
15 0.35
16 0.31
17 0.32
18 0.36
19 0.37
20 0.39
21 0.41
22 0.43
23 0.44
24 0.52
25 0.51
26 0.49
27 0.54
28 0.55
29 0.54
30 0.52
31 0.51
32 0.45
33 0.39
34 0.35
35 0.29
36 0.24
37 0.19
38 0.15
39 0.15
40 0.13
41 0.11
42 0.09
43 0.09
44 0.09
45 0.1
46 0.1
47 0.1
48 0.13
49 0.18
50 0.2
51 0.28
52 0.31
53 0.31
54 0.31
55 0.33
56 0.34
57 0.33
58 0.33
59 0.26
60 0.27
61 0.27
62 0.3
63 0.33
64 0.32
65 0.35
66 0.31
67 0.32
68 0.31
69 0.33
70 0.3
71 0.3
72 0.31
73 0.32
74 0.36
75 0.37
76 0.37
77 0.35
78 0.35
79 0.34
80 0.33
81 0.33
82 0.29
83 0.25
84 0.25
85 0.29
86 0.29
87 0.28
88 0.28
89 0.24
90 0.3
91 0.36
92 0.4