Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9R3I8

Protein Details
Accession A0A2U9R3I8   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKYPEKKKGKKKFFSQLDIPPHydrophilic
NLS Segment(s)
PositionSequence
6-12KKKGKKK
Subcellular Location(s) mito 16.5, mito_nucl 11.833, nucl 6, cyto_nucl 5.333, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007264  H/ACA_rnp_Nop10  
IPR036756  H/ACA_rnp_Nop10_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0030515  F:snoRNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04135  Nop10p  
Amino Acid Sequences MKYPEKKKGKKKFFSQLDIPPTAGSYCHILVQVQENNPPSAAMHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKFSRQRITLKKRFNMLPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.79
4 0.75
5 0.67
6 0.58
7 0.47
8 0.39
9 0.31
10 0.24
11 0.16
12 0.12
13 0.11
14 0.11
15 0.12
16 0.11
17 0.12
18 0.17
19 0.2
20 0.18
21 0.22
22 0.22
23 0.22
24 0.22
25 0.21
26 0.15
27 0.12
28 0.11
29 0.08
30 0.06
31 0.06
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.09
42 0.1
43 0.14
44 0.21
45 0.25
46 0.27
47 0.3
48 0.31
49 0.3
50 0.34
51 0.33
52 0.28
53 0.27
54 0.25
55 0.24
56 0.24
57 0.26
58 0.24
59 0.24
60 0.22
61 0.21
62 0.26
63 0.32
64 0.34
65 0.35
66 0.4
67 0.42
68 0.47
69 0.52
70 0.51
71 0.51
72 0.54
73 0.58
74 0.6
75 0.66
76 0.69
77 0.73
78 0.74
79 0.74