Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A099P297

Protein Details
Accession A0A099P297    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-48VPTLHLKVVHDKNKKKNKKKVEWSDDVIHydrophilic
98-120NAYERQPKYSKKHTHNHDCHEHTHydrophilic
NLS Segment(s)
PositionSequence
32-40KNKKKNKKK
Subcellular Location(s) nucl 21, cyto_nucl 12.833, cyto_pero 2.666, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MPSHSTQGSSTQTQTQQDDEVPTLHLKVVHDKNKKKNKKKVEWSDDVIDNEFLNKKKSKICCIFHPQNPEEYELQPSSDSDSSSESDSESDEDLGEGNAYERQPKYSKKHTHNHDCHEHTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.31
4 0.3
5 0.3
6 0.25
7 0.21
8 0.19
9 0.18
10 0.16
11 0.15
12 0.15
13 0.14
14 0.22
15 0.3
16 0.37
17 0.46
18 0.54
19 0.64
20 0.73
21 0.83
22 0.84
23 0.85
24 0.87
25 0.88
26 0.91
27 0.92
28 0.9
29 0.85
30 0.79
31 0.74
32 0.65
33 0.56
34 0.46
35 0.35
36 0.25
37 0.2
38 0.19
39 0.15
40 0.16
41 0.16
42 0.17
43 0.23
44 0.27
45 0.34
46 0.4
47 0.42
48 0.46
49 0.54
50 0.59
51 0.57
52 0.61
53 0.52
54 0.49
55 0.47
56 0.42
57 0.35
58 0.28
59 0.28
60 0.2
61 0.2
62 0.16
63 0.14
64 0.15
65 0.14
66 0.14
67 0.11
68 0.13
69 0.13
70 0.14
71 0.14
72 0.11
73 0.1
74 0.11
75 0.11
76 0.1
77 0.09
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.05
84 0.05
85 0.08
86 0.08
87 0.14
88 0.14
89 0.19
90 0.25
91 0.33
92 0.41
93 0.49
94 0.59
95 0.63
96 0.73
97 0.78
98 0.84
99 0.85
100 0.86
101 0.86