Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2LEK1

Protein Details
Accession A0A1V2LEK1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
200-223SDPEKVKYVKKVKKSTSPSPRSPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.833, mito_nucl 10.499, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032640  AMPK1_CBM  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
Pfam View protein in Pfam  
PF16561  AMPK1_CBM  
CDD cd02859  E_set_AMPKbeta_like_N  
Amino Acid Sequences MSSYTFTYPAKEGIEDVVVTGTFDNWSQSLPMIKRGKQWEIEVPLSPKDGKIEFKFILNNGEWVISDEYWTVVDDSGNVNNYIELNRETNSWDGNKGGKTTKTTKTEGVNSAYIPESGGLSAKIQSKETDNNASATVMPSTEGIQSTPLGEPGIVVPDTKDPSVNAAFTEVSNVDAKALNAEMKAKEKSKSQSKSQSQNSDPEKVKYVKKVKKSTSPSPRSPTEETPSTGTAKKQGLFSRMKNKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.16
4 0.13
5 0.11
6 0.11
7 0.1
8 0.09
9 0.07
10 0.08
11 0.09
12 0.08
13 0.09
14 0.09
15 0.11
16 0.17
17 0.18
18 0.27
19 0.32
20 0.35
21 0.41
22 0.47
23 0.52
24 0.49
25 0.52
26 0.5
27 0.5
28 0.5
29 0.46
30 0.42
31 0.38
32 0.36
33 0.33
34 0.25
35 0.23
36 0.23
37 0.25
38 0.26
39 0.31
40 0.29
41 0.31
42 0.33
43 0.3
44 0.33
45 0.26
46 0.24
47 0.18
48 0.18
49 0.15
50 0.16
51 0.17
52 0.12
53 0.12
54 0.11
55 0.11
56 0.11
57 0.11
58 0.09
59 0.06
60 0.06
61 0.07
62 0.08
63 0.1
64 0.11
65 0.1
66 0.1
67 0.1
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.1
74 0.11
75 0.12
76 0.13
77 0.15
78 0.14
79 0.13
80 0.13
81 0.16
82 0.16
83 0.17
84 0.19
85 0.19
86 0.23
87 0.29
88 0.35
89 0.37
90 0.38
91 0.4
92 0.4
93 0.43
94 0.41
95 0.38
96 0.31
97 0.26
98 0.25
99 0.21
100 0.17
101 0.13
102 0.1
103 0.06
104 0.06
105 0.06
106 0.05
107 0.05
108 0.08
109 0.12
110 0.12
111 0.13
112 0.14
113 0.16
114 0.19
115 0.22
116 0.23
117 0.2
118 0.2
119 0.2
120 0.19
121 0.17
122 0.14
123 0.11
124 0.07
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.06
131 0.07
132 0.07
133 0.08
134 0.08
135 0.08
136 0.07
137 0.07
138 0.07
139 0.06
140 0.08
141 0.07
142 0.07
143 0.07
144 0.1
145 0.12
146 0.12
147 0.12
148 0.1
149 0.14
150 0.16
151 0.15
152 0.12
153 0.12
154 0.12
155 0.12
156 0.14
157 0.1
158 0.1
159 0.11
160 0.1
161 0.1
162 0.1
163 0.1
164 0.09
165 0.1
166 0.09
167 0.09
168 0.12
169 0.13
170 0.17
171 0.21
172 0.22
173 0.24
174 0.29
175 0.37
176 0.45
177 0.49
178 0.54
179 0.61
180 0.66
181 0.74
182 0.77
183 0.77
184 0.7
185 0.73
186 0.69
187 0.66
188 0.61
189 0.53
190 0.51
191 0.47
192 0.5
193 0.51
194 0.57
195 0.56
196 0.64
197 0.71
198 0.72
199 0.78
200 0.81
201 0.81
202 0.82
203 0.83
204 0.81
205 0.78
206 0.77
207 0.73
208 0.71
209 0.67
210 0.63
211 0.59
212 0.53
213 0.5
214 0.47
215 0.44
216 0.4
217 0.35
218 0.35
219 0.35
220 0.35
221 0.37
222 0.4
223 0.45
224 0.5
225 0.56
226 0.6