Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A099P5L2

Protein Details
Accession A0A099P5L2    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
142-163FNRELSPTRSDKKKKIKMSLKKHydrophilic
NLS Segment(s)
PositionSequence
151-163SDKKKKIKMSLKK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MARRVALNLGQRVRNNNRTFERGRGRQRLLAENDKTVETPVKIRTESGVRGNAVHGSNKSSKRRAEDTQNDIQERSNKKQQVSSHSDPNFKGSSIESEITKTMGFASFSSTQNQHVKGTDCYGINFKHKTEYRQYINREGGFNRELSPTRSDKKKKIKMSLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.59
4 0.59
5 0.61
6 0.62
7 0.62
8 0.63
9 0.63
10 0.69
11 0.7
12 0.69
13 0.66
14 0.67
15 0.66
16 0.63
17 0.63
18 0.56
19 0.49
20 0.46
21 0.42
22 0.38
23 0.31
24 0.27
25 0.19
26 0.2
27 0.22
28 0.24
29 0.23
30 0.24
31 0.25
32 0.26
33 0.28
34 0.29
35 0.29
36 0.25
37 0.25
38 0.26
39 0.26
40 0.23
41 0.22
42 0.18
43 0.19
44 0.25
45 0.32
46 0.37
47 0.39
48 0.41
49 0.44
50 0.49
51 0.49
52 0.53
53 0.53
54 0.54
55 0.56
56 0.56
57 0.51
58 0.46
59 0.43
60 0.4
61 0.37
62 0.36
63 0.36
64 0.35
65 0.36
66 0.4
67 0.42
68 0.43
69 0.47
70 0.45
71 0.47
72 0.46
73 0.49
74 0.44
75 0.44
76 0.36
77 0.27
78 0.24
79 0.16
80 0.16
81 0.16
82 0.17
83 0.14
84 0.14
85 0.14
86 0.14
87 0.13
88 0.1
89 0.08
90 0.08
91 0.08
92 0.07
93 0.12
94 0.15
95 0.16
96 0.19
97 0.19
98 0.24
99 0.27
100 0.29
101 0.25
102 0.24
103 0.26
104 0.25
105 0.27
106 0.25
107 0.21
108 0.21
109 0.24
110 0.24
111 0.27
112 0.28
113 0.25
114 0.31
115 0.34
116 0.38
117 0.44
118 0.5
119 0.52
120 0.58
121 0.63
122 0.63
123 0.66
124 0.63
125 0.57
126 0.49
127 0.47
128 0.4
129 0.36
130 0.29
131 0.27
132 0.27
133 0.27
134 0.31
135 0.33
136 0.39
137 0.48
138 0.55
139 0.6
140 0.69
141 0.76
142 0.8
143 0.84