Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A099P0V0

Protein Details
Accession A0A099P0V0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKRPWRLSSHQKRRQRFRMRTVDSNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, mito_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRATSVNFSGLLWKRPWRLSSHQKRRQRFRMRTVDSNIEALYEGLTANGMSAKKITDLKFNFPKESEMAPRDKYTVFNKHARGYRKGVHFVPKWTKLSLRENPENF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.31
4 0.33
5 0.36
6 0.4
7 0.42
8 0.4
9 0.47
10 0.54
11 0.62
12 0.68
13 0.72
14 0.77
15 0.84
16 0.88
17 0.89
18 0.89
19 0.86
20 0.85
21 0.87
22 0.84
23 0.82
24 0.76
25 0.72
26 0.61
27 0.54
28 0.43
29 0.32
30 0.25
31 0.18
32 0.13
33 0.07
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.08
45 0.12
46 0.13
47 0.2
48 0.22
49 0.29
50 0.37
51 0.39
52 0.39
53 0.35
54 0.36
55 0.3
56 0.32
57 0.3
58 0.25
59 0.27
60 0.28
61 0.28
62 0.28
63 0.27
64 0.28
65 0.29
66 0.35
67 0.36
68 0.41
69 0.44
70 0.48
71 0.54
72 0.56
73 0.55
74 0.52
75 0.54
76 0.54
77 0.56
78 0.53
79 0.57
80 0.54
81 0.58
82 0.61
83 0.61
84 0.57
85 0.54
86 0.55
87 0.53
88 0.59
89 0.59
90 0.59