Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CM09

Protein Details
Accession A1CM09   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-103HTRSRAHKSDRIQKRKKPRSSIVFRPHPSKBasic
NLS Segment(s)
PositionSequence
77-111SRAHKSDRIQKRKKPRSSIVFRPHPSKAKKSSKRK
Subcellular Location(s) mito 21, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG act:ACLA_095290  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSVRASVTKRNRAKLRAAVFGPAVDARTERLSAKLQELASQPITREHGNSSMELDSTKTGIDMDVDKGTVEHTRSRAHKSDRIQKRKKPRSSIVFRPHPSKAKKSSKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.73
4 0.67
5 0.64
6 0.58
7 0.51
8 0.44
9 0.39
10 0.32
11 0.24
12 0.19
13 0.12
14 0.12
15 0.11
16 0.12
17 0.13
18 0.12
19 0.14
20 0.17
21 0.18
22 0.2
23 0.23
24 0.21
25 0.23
26 0.24
27 0.24
28 0.23
29 0.22
30 0.2
31 0.18
32 0.2
33 0.17
34 0.17
35 0.15
36 0.17
37 0.17
38 0.17
39 0.16
40 0.14
41 0.14
42 0.13
43 0.12
44 0.08
45 0.07
46 0.07
47 0.05
48 0.05
49 0.05
50 0.06
51 0.06
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.1
59 0.11
60 0.12
61 0.15
62 0.21
63 0.24
64 0.31
65 0.37
66 0.41
67 0.46
68 0.51
69 0.6
70 0.65
71 0.73
72 0.76
73 0.78
74 0.83
75 0.87
76 0.88
77 0.87
78 0.86
79 0.86
80 0.85
81 0.87
82 0.86
83 0.86
84 0.81
85 0.78
86 0.75
87 0.73
88 0.72
89 0.7
90 0.7
91 0.71