Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9QZM7

Protein Details
Accession A0A2U9QZM7   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-75HLNFPLLQIRKKKRKRKRKHIASRAIKEGCBasic
NLS Segment(s)
PositionSequence
54-69IRKKKRKRKRKHIASR
Subcellular Location(s) nucl 17.5, mito_nucl 13.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MSDFFSRYYGVKSGVEQQEVYESLLIRLEEVTAEFIRGKAYHKPRHLNFPLLQIRKKKRKRKRKHIASRAIKEGCTNPLLVFTHKSVSRVNSTTAEIFPIFQVCEEGREKKSMENRVVVQEEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.29
4 0.27
5 0.28
6 0.27
7 0.26
8 0.18
9 0.14
10 0.13
11 0.15
12 0.14
13 0.11
14 0.1
15 0.09
16 0.07
17 0.08
18 0.1
19 0.08
20 0.1
21 0.09
22 0.09
23 0.11
24 0.12
25 0.14
26 0.19
27 0.29
28 0.36
29 0.43
30 0.52
31 0.53
32 0.63
33 0.63
34 0.6
35 0.52
36 0.54
37 0.55
38 0.5
39 0.53
40 0.51
41 0.57
42 0.62
43 0.7
44 0.72
45 0.74
46 0.81
47 0.88
48 0.9
49 0.92
50 0.93
51 0.94
52 0.94
53 0.95
54 0.93
55 0.87
56 0.83
57 0.73
58 0.62
59 0.52
60 0.43
61 0.35
62 0.25
63 0.21
64 0.13
65 0.15
66 0.16
67 0.16
68 0.17
69 0.15
70 0.19
71 0.19
72 0.21
73 0.2
74 0.23
75 0.27
76 0.26
77 0.28
78 0.26
79 0.27
80 0.27
81 0.25
82 0.24
83 0.19
84 0.17
85 0.15
86 0.14
87 0.12
88 0.1
89 0.12
90 0.1
91 0.14
92 0.18
93 0.23
94 0.24
95 0.27
96 0.28
97 0.33
98 0.41
99 0.45
100 0.46
101 0.48
102 0.49
103 0.53