Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LGK5

Protein Details
Accession E2LGK5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31KLGSPGRKRRHISNNIRTLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 7, extr 3, plas 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014743  Cl-channel_core  
IPR001807  Cl-channel_volt-gated  
Gene Ontology GO:0016020  C:membrane  
GO:0005247  F:voltage-gated chloride channel activity  
KEGG mpr:MPER_05586  -  
Amino Acid Sequences IFVKGALANIVKLGSPGRKRRHISNNIRTLVVPEIKAILRGYVFEAFLTPWTLLIKALGLALAVASGLSLGKKRLCFFASSRISTSDELHQLQLEFLVAFACES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.27
3 0.36
4 0.44
5 0.53
6 0.57
7 0.66
8 0.73
9 0.76
10 0.78
11 0.79
12 0.81
13 0.73
14 0.7
15 0.6
16 0.51
17 0.45
18 0.36
19 0.26
20 0.17
21 0.17
22 0.16
23 0.18
24 0.15
25 0.12
26 0.09
27 0.09
28 0.11
29 0.1
30 0.1
31 0.08
32 0.09
33 0.08
34 0.09
35 0.09
36 0.07
37 0.06
38 0.06
39 0.07
40 0.06
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.04
57 0.06
58 0.1
59 0.12
60 0.14
61 0.18
62 0.19
63 0.22
64 0.24
65 0.32
66 0.36
67 0.36
68 0.37
69 0.36
70 0.37
71 0.35
72 0.35
73 0.3
74 0.29
75 0.28
76 0.27
77 0.25
78 0.23
79 0.22
80 0.19
81 0.14
82 0.09
83 0.08
84 0.07