Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9R8F5

Protein Details
Accession A0A2U9R8F5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-38YATASGFKRPHPQRRHRYKGARLIINDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MDTTLEEYMTVYATASGFKRPHPQRRHRYKGARLIINDEMRRVNSLPAATRPSTTYMSIAAPPSLRPPRKYCDITGLPAHYTAPHNQIRYFDSECYQLVKNMPPGVDQQYLSLRGANVILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.16
4 0.17
5 0.2
6 0.3
7 0.39
8 0.49
9 0.57
10 0.67
11 0.72
12 0.82
13 0.89
14 0.89
15 0.9
16 0.89
17 0.88
18 0.86
19 0.8
20 0.7
21 0.66
22 0.62
23 0.58
24 0.49
25 0.41
26 0.34
27 0.28
28 0.29
29 0.24
30 0.19
31 0.14
32 0.15
33 0.15
34 0.17
35 0.21
36 0.19
37 0.19
38 0.19
39 0.2
40 0.21
41 0.2
42 0.17
43 0.14
44 0.14
45 0.15
46 0.14
47 0.11
48 0.09
49 0.09
50 0.15
51 0.22
52 0.24
53 0.26
54 0.3
55 0.34
56 0.42
57 0.44
58 0.39
59 0.4
60 0.4
61 0.4
62 0.39
63 0.35
64 0.28
65 0.26
66 0.24
67 0.18
68 0.17
69 0.17
70 0.2
71 0.23
72 0.24
73 0.25
74 0.27
75 0.27
76 0.31
77 0.31
78 0.25
79 0.23
80 0.23
81 0.23
82 0.24
83 0.23
84 0.2
85 0.2
86 0.23
87 0.26
88 0.26
89 0.26
90 0.24
91 0.27
92 0.3
93 0.31
94 0.27
95 0.26
96 0.27
97 0.3
98 0.29
99 0.27
100 0.21
101 0.19