Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A099P6Q0

Protein Details
Accession A0A099P6Q0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPSNKRTHQQSNRATKRKTKRQNIGAKYTLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MPSNKRTHQQSNRATKRKTKRQNIGAKYTLYVTNLNSKIKPVKMKENLYILFSSFADVLEIHYPRKDRRGQGWIVVSSPEEAAQCIEKLDNFQMFENQIHVNLARKDANIIGELTKLESHDKEDEDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.84
4 0.85
5 0.85
6 0.85
7 0.84
8 0.85
9 0.91
10 0.88
11 0.86
12 0.79
13 0.69
14 0.59
15 0.51
16 0.42
17 0.34
18 0.27
19 0.2
20 0.25
21 0.27
22 0.28
23 0.26
24 0.28
25 0.31
26 0.34
27 0.4
28 0.35
29 0.42
30 0.48
31 0.52
32 0.53
33 0.54
34 0.5
35 0.45
36 0.41
37 0.31
38 0.24
39 0.2
40 0.16
41 0.1
42 0.09
43 0.07
44 0.07
45 0.07
46 0.09
47 0.1
48 0.1
49 0.11
50 0.13
51 0.14
52 0.21
53 0.24
54 0.25
55 0.3
56 0.36
57 0.36
58 0.39
59 0.42
60 0.36
61 0.32
62 0.28
63 0.23
64 0.17
65 0.15
66 0.11
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.07
73 0.08
74 0.07
75 0.09
76 0.12
77 0.14
78 0.14
79 0.14
80 0.16
81 0.17
82 0.18
83 0.18
84 0.15
85 0.14
86 0.14
87 0.14
88 0.17
89 0.17
90 0.2
91 0.19
92 0.19
93 0.21
94 0.21
95 0.22
96 0.18
97 0.18
98 0.15
99 0.14
100 0.14
101 0.14
102 0.14
103 0.13
104 0.16
105 0.16
106 0.2
107 0.23
108 0.25