Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A099P7A6

Protein Details
Accession A0A099P7A6    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-26RELTPQTPQTPQRHRKRSSGCAFPIHydrophilic
327-349DHYWRSRLPQNKDWQVKHRKPFRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013962  DASH_Dam1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0008608  P:attachment of spindle microtubules to kinetochore  
Pfam View protein in Pfam  
PF08653  DASH_Dam1  
Amino Acid Sequences MRELTPQTPQTPQRHRKRSSGCAFPISSPYTGKSPLPMPVLLPGQYRLGSSVSSEYTNGEAEYDSEENKRRMVVFERPEEGSGNIVPEVGSLLEDMPFFNEERAELFLETASKLSLRTKQLKRTNDTVVELNESLGAYLFGLYQNAWCVNMNESISLETMNKLDKMKKLQKEVEELRQQLAKKNEKSKKDTRPTLSSARLRGNIARTPSSSLVDRLTQIKRKSRGIASNAQQEQQPAQKKRTFLRAGSRTPLFKSRKSSRPVLSGGDRNGMGLQLSDALKYQVSRGEVSDDSLSSVGDTSEVQTLSSIRLNRFNNGLRVSNGNPVLDHYWRSRLPQNKDWQVKHRKPFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.83
4 0.84
5 0.85
6 0.82
7 0.82
8 0.76
9 0.72
10 0.69
11 0.61
12 0.57
13 0.5
14 0.43
15 0.35
16 0.33
17 0.29
18 0.29
19 0.28
20 0.26
21 0.25
22 0.28
23 0.3
24 0.28
25 0.25
26 0.27
27 0.3
28 0.28
29 0.27
30 0.23
31 0.23
32 0.23
33 0.22
34 0.18
35 0.17
36 0.15
37 0.15
38 0.16
39 0.15
40 0.15
41 0.15
42 0.15
43 0.15
44 0.16
45 0.14
46 0.11
47 0.1
48 0.09
49 0.13
50 0.13
51 0.13
52 0.16
53 0.22
54 0.22
55 0.23
56 0.24
57 0.21
58 0.24
59 0.28
60 0.33
61 0.35
62 0.39
63 0.41
64 0.4
65 0.4
66 0.38
67 0.33
68 0.26
69 0.19
70 0.15
71 0.12
72 0.11
73 0.1
74 0.08
75 0.08
76 0.06
77 0.06
78 0.05
79 0.05
80 0.06
81 0.06
82 0.06
83 0.07
84 0.08
85 0.08
86 0.08
87 0.08
88 0.07
89 0.09
90 0.11
91 0.11
92 0.1
93 0.1
94 0.1
95 0.1
96 0.1
97 0.09
98 0.07
99 0.06
100 0.07
101 0.1
102 0.16
103 0.23
104 0.32
105 0.38
106 0.48
107 0.57
108 0.63
109 0.65
110 0.64
111 0.63
112 0.56
113 0.52
114 0.45
115 0.37
116 0.33
117 0.27
118 0.22
119 0.16
120 0.13
121 0.1
122 0.08
123 0.07
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.05
131 0.06
132 0.06
133 0.07
134 0.07
135 0.08
136 0.09
137 0.11
138 0.11
139 0.1
140 0.11
141 0.1
142 0.1
143 0.1
144 0.09
145 0.07
146 0.07
147 0.08
148 0.09
149 0.1
150 0.14
151 0.16
152 0.25
153 0.33
154 0.37
155 0.43
156 0.46
157 0.47
158 0.52
159 0.52
160 0.51
161 0.48
162 0.44
163 0.39
164 0.37
165 0.35
166 0.32
167 0.36
168 0.36
169 0.36
170 0.46
171 0.51
172 0.55
173 0.62
174 0.66
175 0.69
176 0.71
177 0.73
178 0.68
179 0.67
180 0.66
181 0.64
182 0.62
183 0.56
184 0.5
185 0.46
186 0.42
187 0.38
188 0.36
189 0.34
190 0.29
191 0.29
192 0.27
193 0.23
194 0.25
195 0.25
196 0.24
197 0.21
198 0.19
199 0.18
200 0.17
201 0.17
202 0.19
203 0.23
204 0.28
205 0.33
206 0.39
207 0.42
208 0.46
209 0.5
210 0.5
211 0.53
212 0.52
213 0.55
214 0.52
215 0.57
216 0.54
217 0.49
218 0.43
219 0.37
220 0.34
221 0.32
222 0.36
223 0.31
224 0.37
225 0.39
226 0.43
227 0.46
228 0.53
229 0.51
230 0.47
231 0.53
232 0.54
233 0.55
234 0.57
235 0.56
236 0.48
237 0.47
238 0.52
239 0.46
240 0.43
241 0.48
242 0.51
243 0.56
244 0.6
245 0.65
246 0.6
247 0.61
248 0.59
249 0.55
250 0.53
251 0.5
252 0.46
253 0.42
254 0.37
255 0.31
256 0.28
257 0.22
258 0.16
259 0.1
260 0.09
261 0.09
262 0.1
263 0.09
264 0.1
265 0.1
266 0.11
267 0.11
268 0.12
269 0.12
270 0.14
271 0.15
272 0.16
273 0.19
274 0.19
275 0.21
276 0.22
277 0.18
278 0.17
279 0.16
280 0.15
281 0.11
282 0.11
283 0.08
284 0.07
285 0.07
286 0.07
287 0.1
288 0.11
289 0.1
290 0.11
291 0.12
292 0.14
293 0.18
294 0.21
295 0.2
296 0.28
297 0.3
298 0.33
299 0.39
300 0.42
301 0.44
302 0.44
303 0.44
304 0.38
305 0.42
306 0.41
307 0.42
308 0.39
309 0.33
310 0.28
311 0.29
312 0.31
313 0.29
314 0.3
315 0.26
316 0.31
317 0.33
318 0.38
319 0.42
320 0.47
321 0.53
322 0.59
323 0.66
324 0.69
325 0.77
326 0.79
327 0.81
328 0.83
329 0.84