Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A099NUJ5

Protein Details
Accession A0A099NUJ5    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MVSVRKRKMNRSGVAKVRRKNNNKDKFNPKSNPVHydrophilic
NLS Segment(s)
PositionSequence
5-25RKRKMNRSGVAKVRRKNNNKD
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MVSVRKRKMNRSGVAKVRRKNNNKDKFNPKSNPVISKYWDKDLTAKQNYKKLGLTLKIGGPSGGEEKKIVIKPIHHNNMEEDLLESEDESKEELEQEGAEEELDPYDPANILEGTAKMVRNEQGEVVKIIYGTKKITKTGTGASDSQDKEDEDEEEEQTEEAKKVIAELEALAALPKKKEVHKMNELEIYRYEKLIEKYGDDYEKMKWDKKLNPFQLSPGQLRKQIKKYLELHATVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.8
4 0.79
5 0.81
6 0.81
7 0.83
8 0.84
9 0.84
10 0.85
11 0.87
12 0.88
13 0.87
14 0.88
15 0.84
16 0.78
17 0.77
18 0.74
19 0.72
20 0.66
21 0.61
22 0.56
23 0.58
24 0.57
25 0.53
26 0.5
27 0.43
28 0.45
29 0.49
30 0.55
31 0.54
32 0.58
33 0.56
34 0.6
35 0.61
36 0.57
37 0.5
38 0.44
39 0.42
40 0.38
41 0.36
42 0.33
43 0.33
44 0.32
45 0.3
46 0.26
47 0.18
48 0.17
49 0.19
50 0.17
51 0.15
52 0.13
53 0.15
54 0.21
55 0.22
56 0.24
57 0.21
58 0.26
59 0.34
60 0.44
61 0.5
62 0.45
63 0.45
64 0.44
65 0.45
66 0.4
67 0.31
68 0.22
69 0.14
70 0.13
71 0.12
72 0.1
73 0.07
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.05
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.04
89 0.04
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.07
102 0.09
103 0.09
104 0.09
105 0.1
106 0.11
107 0.12
108 0.12
109 0.12
110 0.11
111 0.12
112 0.12
113 0.11
114 0.09
115 0.08
116 0.09
117 0.08
118 0.09
119 0.1
120 0.14
121 0.15
122 0.17
123 0.18
124 0.19
125 0.2
126 0.22
127 0.24
128 0.22
129 0.21
130 0.21
131 0.26
132 0.25
133 0.24
134 0.21
135 0.18
136 0.17
137 0.17
138 0.16
139 0.12
140 0.13
141 0.13
142 0.12
143 0.12
144 0.1
145 0.11
146 0.11
147 0.09
148 0.07
149 0.07
150 0.07
151 0.07
152 0.08
153 0.07
154 0.07
155 0.06
156 0.07
157 0.06
158 0.06
159 0.06
160 0.08
161 0.08
162 0.08
163 0.12
164 0.15
165 0.18
166 0.28
167 0.36
168 0.43
169 0.51
170 0.55
171 0.56
172 0.6
173 0.57
174 0.49
175 0.44
176 0.42
177 0.33
178 0.29
179 0.27
180 0.24
181 0.26
182 0.31
183 0.29
184 0.25
185 0.27
186 0.32
187 0.33
188 0.29
189 0.28
190 0.25
191 0.32
192 0.34
193 0.36
194 0.38
195 0.43
196 0.5
197 0.59
198 0.67
199 0.67
200 0.7
201 0.67
202 0.66
203 0.66
204 0.63
205 0.59
206 0.57
207 0.53
208 0.53
209 0.6
210 0.64
211 0.64
212 0.67
213 0.65
214 0.65
215 0.65
216 0.67
217 0.67