Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9R661

Protein Details
Accession A0A2U9R661    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-29DKLYLAKARRRRGLQQTRFYCQHydrophilic
NLS Segment(s)
PositionSequence
217-229APRKKVAFKLKKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019447  DNA/RNA-bd_Kin17_WH-like_dom  
IPR037321  KIN17-like  
IPR038254  KIN17_WH-like_sf  
IPR036236  Znf_C2H2_sf  
Pfam View protein in Pfam  
PF10357  Kin17_mid  
Amino Acid Sequences MAHTEKADKLYLAKARRRRGLQQTRFYCQLCRRQCLDQHGFALHAKSQSHMRNLEDKLAQHGGDAEKLLRTFSDEFERAFLLKLKSAHGEKLVGLNSCYQEYITDKDAVHLNATRWTSLTRFAIHLRDSGKCRLENVDNGSGEKWLIGYKREPTRREGEKQDLEKQELLEYIDEIVLDEDKVQDKITQDIPTGKVATLEPAPHDQLKDASRAQPLSAPRKKVAFKLKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.59
3 0.67
4 0.71
5 0.73
6 0.77
7 0.79
8 0.81
9 0.83
10 0.8
11 0.78
12 0.78
13 0.69
14 0.66
15 0.62
16 0.62
17 0.59
18 0.59
19 0.56
20 0.58
21 0.63
22 0.65
23 0.63
24 0.57
25 0.53
26 0.47
27 0.45
28 0.39
29 0.35
30 0.27
31 0.24
32 0.2
33 0.19
34 0.25
35 0.28
36 0.32
37 0.33
38 0.34
39 0.38
40 0.39
41 0.43
42 0.38
43 0.34
44 0.34
45 0.33
46 0.29
47 0.22
48 0.23
49 0.18
50 0.16
51 0.17
52 0.12
53 0.12
54 0.12
55 0.12
56 0.09
57 0.12
58 0.12
59 0.14
60 0.19
61 0.19
62 0.19
63 0.2
64 0.21
65 0.17
66 0.17
67 0.19
68 0.13
69 0.16
70 0.16
71 0.17
72 0.2
73 0.21
74 0.22
75 0.19
76 0.19
77 0.16
78 0.19
79 0.19
80 0.15
81 0.15
82 0.15
83 0.15
84 0.14
85 0.14
86 0.1
87 0.09
88 0.1
89 0.12
90 0.12
91 0.14
92 0.14
93 0.15
94 0.17
95 0.17
96 0.16
97 0.15
98 0.14
99 0.15
100 0.16
101 0.14
102 0.13
103 0.14
104 0.13
105 0.15
106 0.16
107 0.12
108 0.14
109 0.16
110 0.18
111 0.18
112 0.2
113 0.18
114 0.21
115 0.23
116 0.26
117 0.27
118 0.25
119 0.25
120 0.26
121 0.27
122 0.27
123 0.29
124 0.3
125 0.27
126 0.28
127 0.27
128 0.23
129 0.2
130 0.16
131 0.11
132 0.07
133 0.08
134 0.1
135 0.12
136 0.19
137 0.29
138 0.36
139 0.38
140 0.4
141 0.48
142 0.53
143 0.56
144 0.56
145 0.56
146 0.57
147 0.6
148 0.63
149 0.58
150 0.54
151 0.5
152 0.43
153 0.35
154 0.28
155 0.25
156 0.16
157 0.13
158 0.11
159 0.09
160 0.08
161 0.07
162 0.07
163 0.06
164 0.06
165 0.06
166 0.07
167 0.08
168 0.09
169 0.1
170 0.11
171 0.12
172 0.16
173 0.2
174 0.2
175 0.21
176 0.25
177 0.26
178 0.27
179 0.27
180 0.24
181 0.21
182 0.2
183 0.21
184 0.19
185 0.18
186 0.18
187 0.21
188 0.24
189 0.25
190 0.25
191 0.23
192 0.26
193 0.27
194 0.29
195 0.28
196 0.3
197 0.33
198 0.33
199 0.33
200 0.33
201 0.39
202 0.44
203 0.48
204 0.49
205 0.48
206 0.55
207 0.58
208 0.62
209 0.65