Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9R6B8

Protein Details
Accession A0A2U9R6B8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-58ANKGIENAGKKKKRKPRHTGPKHDCATHBasic
NLS Segment(s)
PositionSequence
38-51AGKKKKRKPRHTGP
69-74KKKKIK
Subcellular Location(s) nucl 12.5, mito_nucl 12.166, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIRQSVNVKLHHMWKGCRWFLNSGEGSRMTANKGIENAGKKKKRKPRHTGPKHDCATHTRDISFLLKFKKKKIKKFSVFFFFPKSLFPISAFVLYSTNACNTKTEPKIATRLAFFVTQQSQGELTFHQIDPIHPFSHFFPFSRGELTFKTSEIGQASHGVVEPCYVHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.55
4 0.55
5 0.52
6 0.5
7 0.47
8 0.52
9 0.46
10 0.38
11 0.37
12 0.33
13 0.31
14 0.29
15 0.27
16 0.2
17 0.21
18 0.21
19 0.18
20 0.19
21 0.2
22 0.22
23 0.28
24 0.34
25 0.41
26 0.48
27 0.53
28 0.61
29 0.69
30 0.76
31 0.8
32 0.83
33 0.84
34 0.87
35 0.92
36 0.94
37 0.91
38 0.9
39 0.82
40 0.74
41 0.65
42 0.58
43 0.53
44 0.47
45 0.41
46 0.31
47 0.28
48 0.28
49 0.28
50 0.24
51 0.22
52 0.23
53 0.29
54 0.31
55 0.38
56 0.47
57 0.52
58 0.61
59 0.68
60 0.72
61 0.74
62 0.79
63 0.78
64 0.75
65 0.7
66 0.61
67 0.55
68 0.45
69 0.36
70 0.3
71 0.25
72 0.18
73 0.15
74 0.15
75 0.12
76 0.12
77 0.12
78 0.12
79 0.1
80 0.1
81 0.1
82 0.09
83 0.08
84 0.1
85 0.1
86 0.1
87 0.11
88 0.13
89 0.2
90 0.22
91 0.25
92 0.25
93 0.26
94 0.31
95 0.33
96 0.32
97 0.25
98 0.25
99 0.23
100 0.21
101 0.19
102 0.18
103 0.17
104 0.17
105 0.17
106 0.16
107 0.15
108 0.15
109 0.16
110 0.11
111 0.14
112 0.15
113 0.14
114 0.16
115 0.16
116 0.17
117 0.22
118 0.25
119 0.21
120 0.18
121 0.2
122 0.2
123 0.28
124 0.28
125 0.23
126 0.24
127 0.26
128 0.27
129 0.29
130 0.28
131 0.23
132 0.24
133 0.28
134 0.26
135 0.23
136 0.23
137 0.19
138 0.22
139 0.2
140 0.19
141 0.15
142 0.17
143 0.17
144 0.17
145 0.18
146 0.15
147 0.13
148 0.14