Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2U9R6A8

Protein Details
Accession A0A2U9R6A8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-86KKEDWFRYNRKLIKKQNVQRIKMNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRQSVRFFGSTRAVLQSSCKEGTPINLNIYKAGKPIVAKKDEEYPDWLWGLLDNDLQMENLKKEDWFRYNRKLIKKQNVQRIKMNNFMNNMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.28
4 0.27
5 0.27
6 0.26
7 0.24
8 0.22
9 0.21
10 0.25
11 0.27
12 0.25
13 0.25
14 0.27
15 0.27
16 0.29
17 0.3
18 0.26
19 0.21
20 0.19
21 0.16
22 0.15
23 0.22
24 0.26
25 0.27
26 0.27
27 0.28
28 0.35
29 0.35
30 0.35
31 0.32
32 0.26
33 0.25
34 0.24
35 0.22
36 0.14
37 0.13
38 0.13
39 0.08
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.09
50 0.09
51 0.12
52 0.18
53 0.24
54 0.31
55 0.37
56 0.45
57 0.54
58 0.6
59 0.68
60 0.72
61 0.76
62 0.79
63 0.83
64 0.82
65 0.84
66 0.87
67 0.82
68 0.8
69 0.8
70 0.75
71 0.72
72 0.69
73 0.64