Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z8JKM8

Protein Details
Accession A0A1Z8JKM8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
153-191ETVKKDVFRVYKPKKRKRSGVRSKMKSLRSKQNRVEDIFHydrophilic
NLS Segment(s)
PositionSequence
161-183RVYKPKKRKRSGVRSKMKSLRSK
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MAKLTDSGSTRNRSESVSQNVGAVEFVQVVKQEHGYDEKEYKKILRSEIEKESKKPRNIFLIYRSLVKQYLMNYLSIKGFTEISEESGKLWKSRSSEVEHYVKYLAEQEERFFENEQTQRLKDRSSSASEKLKEKTLSQLTVDGYNGREPKGETVKKDVFRVYKPKKRKRSGVRSKMKSLRSKQNRVEDIFCVPNIEFQDIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.42
4 0.42
5 0.4
6 0.38
7 0.36
8 0.33
9 0.28
10 0.2
11 0.12
12 0.08
13 0.08
14 0.08
15 0.09
16 0.11
17 0.12
18 0.13
19 0.13
20 0.14
21 0.18
22 0.2
23 0.23
24 0.27
25 0.3
26 0.31
27 0.32
28 0.33
29 0.35
30 0.37
31 0.37
32 0.38
33 0.39
34 0.42
35 0.5
36 0.57
37 0.54
38 0.55
39 0.61
40 0.62
41 0.64
42 0.62
43 0.57
44 0.57
45 0.57
46 0.57
47 0.52
48 0.52
49 0.46
50 0.45
51 0.41
52 0.34
53 0.3
54 0.26
55 0.23
56 0.16
57 0.22
58 0.2
59 0.2
60 0.19
61 0.2
62 0.19
63 0.17
64 0.16
65 0.1
66 0.1
67 0.08
68 0.1
69 0.09
70 0.11
71 0.12
72 0.12
73 0.11
74 0.15
75 0.15
76 0.13
77 0.14
78 0.15
79 0.16
80 0.2
81 0.23
82 0.25
83 0.28
84 0.33
85 0.36
86 0.33
87 0.31
88 0.28
89 0.24
90 0.19
91 0.18
92 0.14
93 0.12
94 0.13
95 0.13
96 0.14
97 0.16
98 0.16
99 0.14
100 0.14
101 0.17
102 0.18
103 0.21
104 0.21
105 0.21
106 0.25
107 0.25
108 0.25
109 0.22
110 0.24
111 0.25
112 0.28
113 0.31
114 0.32
115 0.38
116 0.4
117 0.42
118 0.4
119 0.42
120 0.37
121 0.34
122 0.38
123 0.35
124 0.34
125 0.31
126 0.32
127 0.27
128 0.27
129 0.27
130 0.19
131 0.16
132 0.19
133 0.19
134 0.16
135 0.16
136 0.16
137 0.22
138 0.31
139 0.34
140 0.32
141 0.39
142 0.46
143 0.48
144 0.5
145 0.49
146 0.44
147 0.47
148 0.56
149 0.57
150 0.6
151 0.68
152 0.76
153 0.81
154 0.86
155 0.9
156 0.9
157 0.91
158 0.92
159 0.92
160 0.93
161 0.9
162 0.9
163 0.88
164 0.86
165 0.84
166 0.81
167 0.81
168 0.81
169 0.83
170 0.82
171 0.84
172 0.83
173 0.78
174 0.73
175 0.64
176 0.6
177 0.53
178 0.44
179 0.36
180 0.29
181 0.28
182 0.27