Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LAA1

Protein Details
Accession E2LAA1    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-102AIGLWFCFCRRRRRRQNVPMQGTASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8extr 8, cyto 6, pero 2, nucl 1, plas 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mpr:MPER_02991  -  
Amino Acid Sequences MACSPLAPTTIAVTPASIAVATTSNSIGVGDTTTVTATNPPPPPPSQLPLAENEGGKENVGLIVGSVVVGVLLGILLAIGLWFCFCRRRRRRQNVPMQGTASSSDDVTMGDEYGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.08
5 0.07
6 0.06
7 0.07
8 0.07
9 0.08
10 0.08
11 0.08
12 0.08
13 0.08
14 0.07
15 0.06
16 0.06
17 0.05
18 0.05
19 0.06
20 0.06
21 0.06
22 0.06
23 0.08
24 0.09
25 0.15
26 0.17
27 0.19
28 0.22
29 0.23
30 0.28
31 0.29
32 0.3
33 0.28
34 0.28
35 0.27
36 0.27
37 0.29
38 0.25
39 0.21
40 0.2
41 0.17
42 0.15
43 0.14
44 0.11
45 0.07
46 0.06
47 0.06
48 0.05
49 0.03
50 0.03
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.01
59 0.01
60 0.01
61 0.01
62 0.01
63 0.01
64 0.01
65 0.01
66 0.01
67 0.02
68 0.02
69 0.03
70 0.04
71 0.12
72 0.17
73 0.29
74 0.39
75 0.5
76 0.62
77 0.73
78 0.84
79 0.87
80 0.93
81 0.93
82 0.91
83 0.85
84 0.76
85 0.66
86 0.56
87 0.47
88 0.38
89 0.27
90 0.2
91 0.14
92 0.12
93 0.11
94 0.12
95 0.1