FuNGI

A0A099P7Z1

Protein Details

Accession

A0A099P7Z1

Localization Confidence

High

Confidence Score

15.3

NoLS Segment(s)

Position	Sequence	Protein Nature
97-125	SDTNDPSKSKHRKRTIPSHLVKRLNKNKS	Hydrophilic

NLS Segment(s)

Position	Sequence
107-110	HRKR

Subcellular Location(s)

nucl 19, cyto 5, mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR017389 Nucleoporin_NUP53 IPR012677 Nucleotide-bd_a/b_plait_sf IPR035979 RBD_domain_sf IPR007846 RRM_NUP35_dom
Gene Ontology	GO:0031965 C:nuclear membrane GO:0005643 C:nuclear pore GO:0003676 F:nucleic acid binding GO:0017056 F:structural constituent of nuclear pore GO:0051028 P:mRNA transport GO:0015031 P:protein transport
Pfam	View protein in Pfam PF05172 Nup35_RRM
PROSITE	View protein in PROSITE PS51472 RRM_NUP35

Amino Acid Sequences

MFGGINTSAPNKQSLFGNSGASSSKTNTFSQPYQQQQQQLQQVQPTQGLPLQSSIFQNPGQAIQQMKSPSRFEKYELKGASEPKLFASDVKTGASHSDTNDPSKSKHRKRTIPSHLVKRLNKNKSTLDEEDKPSVPILPFKATKQSQTDTFDEDFAYLYEHDKLPSRSLLDPLTFNDEYTPGEILMEGSDFNKMTQEPFEFKNAFQRPNRSTISQKTTGKENRETKLPWSKTSNEMQIDDSDLSVKTELVPTDTKQTRSLTSEKLYCAVIVYGFDDENFRVLIEHFAKYGKIMEDLMISDFNYYYGQPGNVLAVDKLVDINDRSNAKLGNKNAFPIFLGEGWVKITYDNPNSAIRALADNLISDNNGNILGVIPYTREDLELLLGQKISDSMDVGAGLKGLNHELELDMKLADNYIGRYLRAARNGLTRKDSNSGDLRSKSLAIKDGSNLLLKKDKHENRKTIWNSGMGFLFGKGEI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.3
3	0.29
4	0.31
5	0.28
6	0.28
7	0.28
8	0.25
9	0.23
10	0.22
11	0.26
12	0.26
13	0.28
14	0.32
15	0.36
16	0.38
17	0.45
18	0.51
19	0.53
20	0.57
21	0.6
22	0.62
23	0.62
24	0.66
25	0.66
26	0.63
27	0.58
28	0.55
29	0.54
30	0.49
31	0.45
32	0.38
33	0.31
34	0.27
35	0.25
36	0.21
37	0.2
38	0.19
39	0.19
40	0.21
41	0.2
42	0.21
43	0.2
44	0.21
45	0.19
46	0.2
47	0.19
48	0.2
49	0.2
50	0.18
51	0.22
52	0.26
53	0.29
54	0.32
55	0.35
56	0.37
57	0.41
58	0.42
59	0.42
60	0.47
61	0.48
62	0.52
63	0.49
64	0.48
65	0.47
66	0.48
67	0.5
68	0.43
69	0.38
70	0.3
71	0.32
72	0.27
73	0.24
74	0.25
75	0.22
76	0.21
77	0.21
78	0.2
79	0.18
80	0.2
81	0.21
82	0.19
83	0.17
84	0.23
85	0.24
86	0.28
87	0.31
88	0.31
89	0.31
90	0.4
91	0.49
92	0.51
93	0.6
94	0.66
95	0.72
96	0.79
97	0.87
98	0.88
99	0.88
100	0.86
101	0.86
102	0.85
103	0.85
104	0.82
105	0.82
106	0.81
107	0.79
108	0.75
109	0.69
110	0.66
111	0.62
112	0.63
113	0.58
114	0.55
115	0.52
116	0.52
117	0.51
118	0.46
119	0.41
120	0.34
121	0.31
122	0.24
123	0.22
124	0.2
125	0.22
126	0.23
127	0.23
128	0.32
129	0.31
130	0.36
131	0.37
132	0.37
133	0.37
134	0.4
135	0.41
136	0.37
137	0.36
138	0.32
139	0.27
140	0.24
141	0.18
142	0.13
143	0.13
144	0.08
145	0.08
146	0.1
147	0.1
148	0.11
149	0.15
150	0.16
151	0.17
152	0.19
153	0.21
154	0.2
155	0.22
156	0.23
157	0.21
158	0.2
159	0.19
160	0.24
161	0.21
162	0.2
163	0.18
164	0.17
165	0.16
166	0.16
167	0.15
168	0.07
169	0.07
170	0.07
171	0.07
172	0.06
173	0.06
174	0.05
175	0.04
176	0.06
177	0.06
178	0.06
179	0.07
180	0.07
181	0.08
182	0.1
183	0.12
184	0.14
185	0.15
186	0.2
187	0.2
188	0.2
189	0.29
190	0.31
191	0.35
192	0.36
193	0.42
194	0.39
195	0.45
196	0.47
197	0.4
198	0.41
199	0.42
200	0.46
201	0.45
202	0.46
203	0.41
204	0.48
205	0.5
206	0.5
207	0.52
208	0.51
209	0.45
210	0.46
211	0.46
212	0.43
213	0.48
214	0.45
215	0.39
216	0.38
217	0.38
218	0.38
219	0.41
220	0.4
221	0.32
222	0.31
223	0.28
224	0.24
225	0.24
226	0.19
227	0.15
228	0.1
229	0.09
230	0.08
231	0.07
232	0.07
233	0.05
234	0.07
235	0.07
236	0.09
237	0.1
238	0.1
239	0.19
240	0.21
241	0.22
242	0.24
243	0.26
244	0.25
245	0.28
246	0.31
247	0.26
248	0.27
249	0.28
250	0.25
251	0.25
252	0.23
253	0.19
254	0.16
255	0.12
256	0.09
257	0.06
258	0.07
259	0.06
260	0.06
261	0.06
262	0.07
263	0.07
264	0.07
265	0.07
266	0.06
267	0.06
268	0.06
269	0.11
270	0.12
271	0.13
272	0.13
273	0.13
274	0.13
275	0.13
276	0.15
277	0.11
278	0.1
279	0.1
280	0.1
281	0.1
282	0.1
283	0.11
284	0.09
285	0.08
286	0.08
287	0.07
288	0.07
289	0.07
290	0.07
291	0.07
292	0.08
293	0.08
294	0.08
295	0.08
296	0.08
297	0.08
298	0.09
299	0.07
300	0.07
301	0.07
302	0.06
303	0.07
304	0.06
305	0.07
306	0.07
307	0.09
308	0.13
309	0.14
310	0.14
311	0.16
312	0.18
313	0.21
314	0.26
315	0.29
316	0.32
317	0.31
318	0.33
319	0.32
320	0.3
321	0.26
322	0.22
323	0.2
324	0.13
325	0.14
326	0.12
327	0.11
328	0.12
329	0.12
330	0.1
331	0.09
332	0.11
333	0.15
334	0.18
335	0.19
336	0.21
337	0.22
338	0.23
339	0.23
340	0.21
341	0.16
342	0.15
343	0.14
344	0.13
345	0.12
346	0.11
347	0.11
348	0.11
349	0.1
350	0.09
351	0.08
352	0.07
353	0.06
354	0.06
355	0.05
356	0.05
357	0.05
358	0.05
359	0.05
360	0.05
361	0.06
362	0.08
363	0.09
364	0.09
365	0.09
366	0.09
367	0.11
368	0.13
369	0.13
370	0.13
371	0.13
372	0.12
373	0.12
374	0.12
375	0.11
376	0.08
377	0.08
378	0.07
379	0.08
380	0.08
381	0.09
382	0.09
383	0.08
384	0.07
385	0.07
386	0.07
387	0.08
388	0.08
389	0.07
390	0.08
391	0.08
392	0.11
393	0.11
394	0.11
395	0.1
396	0.1
397	0.1
398	0.1
399	0.1
400	0.09
401	0.1
402	0.15
403	0.16
404	0.15
405	0.18
406	0.24
407	0.28
408	0.32
409	0.33
410	0.3
411	0.4
412	0.47
413	0.49
414	0.5
415	0.48
416	0.47
417	0.5
418	0.49
419	0.45
420	0.45
421	0.45
422	0.46
423	0.45
424	0.43
425	0.39
426	0.41
427	0.38
428	0.35
429	0.36
430	0.3
431	0.31
432	0.3
433	0.33
434	0.32
435	0.34
436	0.32
437	0.3
438	0.35
439	0.34
440	0.37
441	0.44
442	0.51
443	0.56
444	0.66
445	0.7
446	0.68
447	0.79
448	0.78
449	0.75
450	0.7
451	0.65
452	0.57
453	0.52
454	0.46
455	0.37
456	0.32
457	0.25

A0A099P7Z1

3D AlphaFold-predicted Structure Viewer