Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9R321

Protein Details
Accession A0A2U9R321    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
283-304IEVYRKSSKKAKVVKKVRGGVAHydrophilic
NLS Segment(s)
PositionSequence
289-300SSKKAKVVKKVR
Subcellular Location(s) plas 19, E.R. 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR030457  ELO_CS  
IPR002076  ELO_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0006633  P:fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF01151  ELO  
PROSITE View protein in PROSITE  
PS01188  ELO  
Amino Acid Sequences MSSFNGIPFPSIDRPFGVEIFPHVEKIFRFLSNGHFVMSEFEFVQDETFLSTPYPVFAAIVVYYTVIFGGDKLMKSFNVKPFVLNGLFQIHNLFLTTLSLTLLLCFIEQLVPQIYYNGLFYAICDERAWTQKLVVLYYMNYLTKYLEFIDTVFLVLKQKKLTFLHTYHHGATALLCYTQLVGTTPISWVPISLNLFVHVVMYWYYFLAARGIRVWWKEWVTRFQIIQFLIDLGFIYFAVYIKVMSGIDTKYTAGLTCSGTKIATISGCSIISSYLFLFIAFYIEVYRKSSKKAKVVKKVRGGVAAKVNEYVLLDKKTIQENFDSNTGSPIPTRRRTGKKLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.3
4 0.25
5 0.19
6 0.2
7 0.24
8 0.23
9 0.22
10 0.2
11 0.21
12 0.21
13 0.25
14 0.25
15 0.19
16 0.2
17 0.2
18 0.27
19 0.31
20 0.32
21 0.28
22 0.24
23 0.24
24 0.26
25 0.25
26 0.2
27 0.13
28 0.13
29 0.13
30 0.13
31 0.13
32 0.1
33 0.09
34 0.1
35 0.1
36 0.09
37 0.09
38 0.1
39 0.09
40 0.1
41 0.1
42 0.08
43 0.08
44 0.07
45 0.08
46 0.07
47 0.08
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.05
54 0.05
55 0.04
56 0.08
57 0.11
58 0.11
59 0.13
60 0.15
61 0.15
62 0.21
63 0.27
64 0.3
65 0.34
66 0.34
67 0.33
68 0.34
69 0.38
70 0.34
71 0.27
72 0.22
73 0.2
74 0.2
75 0.19
76 0.18
77 0.13
78 0.12
79 0.12
80 0.11
81 0.06
82 0.07
83 0.07
84 0.06
85 0.06
86 0.07
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.04
93 0.04
94 0.05
95 0.05
96 0.07
97 0.08
98 0.09
99 0.09
100 0.1
101 0.09
102 0.09
103 0.09
104 0.08
105 0.07
106 0.06
107 0.06
108 0.11
109 0.11
110 0.11
111 0.11
112 0.11
113 0.14
114 0.18
115 0.21
116 0.15
117 0.16
118 0.17
119 0.18
120 0.17
121 0.16
122 0.12
123 0.1
124 0.11
125 0.12
126 0.11
127 0.1
128 0.1
129 0.1
130 0.09
131 0.1
132 0.09
133 0.08
134 0.08
135 0.08
136 0.09
137 0.08
138 0.08
139 0.07
140 0.07
141 0.1
142 0.11
143 0.13
144 0.14
145 0.14
146 0.19
147 0.2
148 0.25
149 0.27
150 0.28
151 0.29
152 0.32
153 0.35
154 0.3
155 0.3
156 0.25
157 0.19
158 0.17
159 0.15
160 0.1
161 0.07
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.06
169 0.06
170 0.06
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.06
177 0.09
178 0.1
179 0.11
180 0.11
181 0.11
182 0.11
183 0.11
184 0.11
185 0.07
186 0.06
187 0.06
188 0.06
189 0.05
190 0.05
191 0.06
192 0.06
193 0.06
194 0.08
195 0.08
196 0.08
197 0.08
198 0.1
199 0.12
200 0.13
201 0.15
202 0.17
203 0.19
204 0.23
205 0.25
206 0.3
207 0.32
208 0.34
209 0.33
210 0.3
211 0.31
212 0.28
213 0.25
214 0.19
215 0.15
216 0.12
217 0.11
218 0.1
219 0.05
220 0.05
221 0.04
222 0.04
223 0.04
224 0.04
225 0.05
226 0.05
227 0.05
228 0.05
229 0.06
230 0.05
231 0.06
232 0.08
233 0.08
234 0.1
235 0.11
236 0.11
237 0.1
238 0.1
239 0.1
240 0.08
241 0.1
242 0.12
243 0.13
244 0.14
245 0.14
246 0.14
247 0.13
248 0.13
249 0.13
250 0.11
251 0.1
252 0.11
253 0.12
254 0.12
255 0.12
256 0.12
257 0.1
258 0.1
259 0.1
260 0.08
261 0.08
262 0.08
263 0.08
264 0.08
265 0.08
266 0.09
267 0.07
268 0.07
269 0.08
270 0.09
271 0.11
272 0.15
273 0.21
274 0.21
275 0.28
276 0.36
277 0.42
278 0.5
279 0.6
280 0.66
281 0.71
282 0.8
283 0.83
284 0.84
285 0.84
286 0.78
287 0.77
288 0.68
289 0.63
290 0.62
291 0.55
292 0.46
293 0.4
294 0.36
295 0.28
296 0.27
297 0.24
298 0.2
299 0.2
300 0.19
301 0.21
302 0.25
303 0.32
304 0.33
305 0.32
306 0.32
307 0.33
308 0.36
309 0.37
310 0.36
311 0.28
312 0.3
313 0.29
314 0.24
315 0.24
316 0.29
317 0.34
318 0.39
319 0.47
320 0.54
321 0.62