Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9R121

Protein Details
Accession A0A2U9R121    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
428-449EQINSKWRGKKLESKKRPHTNIHydrophilic
NLS Segment(s)
PositionSequence
435-445RGKKLESKKRP
Subcellular Location(s) mito 18.5, mito_nucl 13.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020097  PsdUridine_synth_TruA_a/b_dom  
IPR020095  PsdUridine_synth_TruA_C  
IPR041707  Pus3-like  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01416  PseudoU_synth_1  
CDD cd02569  PseudoU_synth_ScPus3  
Amino Acid Sequences MLNRCLMLIPKIRLSGQSIRIFARFQSMTAGKMETQSNDYSNWSRKQLLSKIYELEGRNSKLEQSDTVDEKVVENLPKTKKQKTFDFSKYTKRKIALRFSYLGWNYQGLALQGERTELPTVEEKIMEALFRIKLIGSINQEECDFSRCGRTDRGVSAMNQVISLTVRSKLTEEELKDPKNDEKEIDYIKSINQALPDDIRVHSACLRPPKDFDARFSCTFRHYKYIFNGDGLDIDAMNTAASYYLGENDFRNFCKIDASKQITNFKRSILVSQIDPIEGEKNMYVFNLKGTAFLWHQVRCMVAVLLTVGQGLEAPEIVKELLDISLNPSRPTYKMAHDIPLVLYDCGFTDNVKWTSGPMRNFNVNASVNGLWNDYKIKAIISDFMRSFCNMKYKDDSQKIHINLGDGLGQAMKKYIMYEYRPKLETAEQINSKWRGKKLESKKRPHTNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.44
4 0.47
5 0.45
6 0.45
7 0.46
8 0.44
9 0.38
10 0.38
11 0.29
12 0.23
13 0.29
14 0.27
15 0.27
16 0.28
17 0.3
18 0.22
19 0.25
20 0.27
21 0.21
22 0.24
23 0.25
24 0.25
25 0.24
26 0.28
27 0.31
28 0.36
29 0.38
30 0.39
31 0.4
32 0.43
33 0.5
34 0.52
35 0.54
36 0.52
37 0.51
38 0.5
39 0.48
40 0.5
41 0.43
42 0.43
43 0.42
44 0.39
45 0.37
46 0.35
47 0.35
48 0.32
49 0.32
50 0.28
51 0.26
52 0.3
53 0.31
54 0.31
55 0.31
56 0.28
57 0.27
58 0.27
59 0.25
60 0.21
61 0.2
62 0.27
63 0.31
64 0.4
65 0.46
66 0.52
67 0.56
68 0.61
69 0.68
70 0.67
71 0.71
72 0.7
73 0.74
74 0.7
75 0.73
76 0.75
77 0.72
78 0.71
79 0.66
80 0.65
81 0.64
82 0.7
83 0.67
84 0.63
85 0.59
86 0.55
87 0.6
88 0.52
89 0.46
90 0.36
91 0.29
92 0.24
93 0.22
94 0.21
95 0.12
96 0.13
97 0.11
98 0.1
99 0.1
100 0.1
101 0.1
102 0.1
103 0.11
104 0.1
105 0.12
106 0.15
107 0.17
108 0.17
109 0.17
110 0.15
111 0.15
112 0.15
113 0.13
114 0.1
115 0.1
116 0.1
117 0.1
118 0.1
119 0.08
120 0.1
121 0.12
122 0.16
123 0.16
124 0.2
125 0.21
126 0.22
127 0.22
128 0.21
129 0.2
130 0.19
131 0.16
132 0.12
133 0.18
134 0.18
135 0.21
136 0.24
137 0.26
138 0.26
139 0.27
140 0.3
141 0.26
142 0.25
143 0.27
144 0.26
145 0.23
146 0.19
147 0.18
148 0.14
149 0.12
150 0.13
151 0.09
152 0.09
153 0.09
154 0.1
155 0.11
156 0.11
157 0.14
158 0.18
159 0.19
160 0.25
161 0.3
162 0.31
163 0.31
164 0.33
165 0.33
166 0.32
167 0.31
168 0.25
169 0.22
170 0.25
171 0.26
172 0.25
173 0.22
174 0.18
175 0.18
176 0.2
177 0.18
178 0.15
179 0.14
180 0.13
181 0.14
182 0.14
183 0.15
184 0.12
185 0.12
186 0.13
187 0.12
188 0.13
189 0.15
190 0.16
191 0.18
192 0.25
193 0.27
194 0.26
195 0.28
196 0.31
197 0.36
198 0.35
199 0.36
200 0.35
201 0.38
202 0.4
203 0.39
204 0.35
205 0.32
206 0.34
207 0.31
208 0.32
209 0.28
210 0.29
211 0.31
212 0.37
213 0.33
214 0.3
215 0.29
216 0.21
217 0.2
218 0.16
219 0.13
220 0.06
221 0.06
222 0.05
223 0.04
224 0.04
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.05
232 0.06
233 0.07
234 0.07
235 0.1
236 0.11
237 0.12
238 0.14
239 0.13
240 0.12
241 0.18
242 0.18
243 0.2
244 0.28
245 0.33
246 0.34
247 0.38
248 0.47
249 0.44
250 0.47
251 0.44
252 0.35
253 0.34
254 0.31
255 0.29
256 0.25
257 0.23
258 0.19
259 0.21
260 0.2
261 0.16
262 0.15
263 0.14
264 0.11
265 0.09
266 0.1
267 0.08
268 0.08
269 0.08
270 0.08
271 0.08
272 0.07
273 0.07
274 0.1
275 0.1
276 0.1
277 0.1
278 0.13
279 0.12
280 0.17
281 0.19
282 0.17
283 0.17
284 0.18
285 0.17
286 0.15
287 0.15
288 0.11
289 0.08
290 0.07
291 0.07
292 0.06
293 0.06
294 0.06
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.05
304 0.05
305 0.05
306 0.04
307 0.05
308 0.05
309 0.06
310 0.06
311 0.1
312 0.15
313 0.16
314 0.17
315 0.18
316 0.19
317 0.2
318 0.24
319 0.23
320 0.23
321 0.3
322 0.32
323 0.35
324 0.34
325 0.34
326 0.3
327 0.3
328 0.27
329 0.19
330 0.16
331 0.12
332 0.12
333 0.12
334 0.11
335 0.08
336 0.09
337 0.16
338 0.17
339 0.18
340 0.18
341 0.18
342 0.26
343 0.32
344 0.34
345 0.33
346 0.37
347 0.4
348 0.41
349 0.4
350 0.39
351 0.35
352 0.31
353 0.29
354 0.25
355 0.22
356 0.22
357 0.22
358 0.15
359 0.15
360 0.17
361 0.14
362 0.15
363 0.14
364 0.13
365 0.14
366 0.15
367 0.2
368 0.2
369 0.26
370 0.25
371 0.26
372 0.27
373 0.26
374 0.27
375 0.24
376 0.31
377 0.27
378 0.32
379 0.38
380 0.44
381 0.53
382 0.6
383 0.6
384 0.57
385 0.64
386 0.61
387 0.58
388 0.52
389 0.44
390 0.35
391 0.32
392 0.27
393 0.18
394 0.17
395 0.14
396 0.13
397 0.11
398 0.11
399 0.1
400 0.09
401 0.1
402 0.15
403 0.2
404 0.27
405 0.37
406 0.43
407 0.49
408 0.5
409 0.5
410 0.48
411 0.46
412 0.47
413 0.44
414 0.47
415 0.43
416 0.44
417 0.52
418 0.55
419 0.56
420 0.56
421 0.55
422 0.54
423 0.58
424 0.66
425 0.69
426 0.75
427 0.79
428 0.83
429 0.88