Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A099NUW6

Protein Details
Accession A0A099NUW6    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
134-163LMEKRLYHNLKERKRKKTPEDKVSKKRKVLBasic
NLS Segment(s)
PositionSequence
144-163KERKRKKTPEDKVSKKRKVL
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MYTKCPITNKPLEEPIVSDWRGHLYSKEAVIGELLQKKGRFKSLNDVIDIKIRLENGKLTCPLSGKVVDLLDDDVTLQELQFSYIVPCGCAMNTKVLRDLNAVRCPLCHEPFDQQNIIDINGNEAELQKRMDTLMEKRLYHNLKERKRKKTPEDKVSKKRKVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.4
4 0.36
5 0.3
6 0.25
7 0.26
8 0.27
9 0.25
10 0.21
11 0.18
12 0.21
13 0.22
14 0.23
15 0.19
16 0.18
17 0.17
18 0.17
19 0.18
20 0.2
21 0.2
22 0.22
23 0.23
24 0.27
25 0.29
26 0.36
27 0.34
28 0.32
29 0.41
30 0.46
31 0.48
32 0.46
33 0.45
34 0.38
35 0.4
36 0.38
37 0.28
38 0.2
39 0.18
40 0.16
41 0.15
42 0.19
43 0.16
44 0.19
45 0.19
46 0.19
47 0.19
48 0.2
49 0.19
50 0.17
51 0.16
52 0.13
53 0.13
54 0.12
55 0.11
56 0.11
57 0.11
58 0.08
59 0.07
60 0.07
61 0.05
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.08
78 0.09
79 0.15
80 0.16
81 0.17
82 0.2
83 0.2
84 0.21
85 0.22
86 0.27
87 0.25
88 0.28
89 0.28
90 0.25
91 0.25
92 0.29
93 0.32
94 0.29
95 0.24
96 0.22
97 0.26
98 0.31
99 0.35
100 0.31
101 0.25
102 0.26
103 0.26
104 0.24
105 0.22
106 0.17
107 0.14
108 0.14
109 0.14
110 0.11
111 0.11
112 0.12
113 0.11
114 0.12
115 0.1
116 0.1
117 0.1
118 0.12
119 0.16
120 0.19
121 0.27
122 0.31
123 0.32
124 0.34
125 0.43
126 0.45
127 0.46
128 0.52
129 0.53
130 0.57
131 0.68
132 0.75
133 0.76
134 0.83
135 0.88
136 0.89
137 0.9
138 0.91
139 0.91
140 0.93
141 0.93
142 0.93
143 0.94