Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z8JNS4

Protein Details
Accession A0A1Z8JNS4    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-75KTVSMQKIKDNKEKIKNNKQLPYLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 13, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005937  26S_Psome_P45-like  
IPR003593  AAA+_ATPase  
IPR041569  AAA_lid_3  
IPR003959  ATPase_AAA_core  
IPR003960  ATPase_AAA_CS  
IPR012340  NA-bd_OB-fold  
IPR027417  P-loop_NTPase  
IPR032501  Prot_ATP_ID_OB_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0008540  C:proteasome regulatory particle, base subcomplex  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0008233  F:peptidase activity  
GO:0036402  F:proteasome-activating activity  
GO:0070682  P:proteasome regulatory particle assembly  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00004  AAA  
PF17862  AAA_lid_3  
PF16450  Prot_ATP_ID_OB  
PROSITE View protein in PROSITE  
PS00674  AAA  
Amino Acid Sequences MATLEDLENNPDLQIDDEILNSSTTDIKNRTKLLDNEIRIFKSEYLRLQHDKTVSMQKIKDNKEKIKNNKQLPYLVGNVVELLDLDAEENATNEGANVDLDSTRVGKSAVIKTSTRQTVFLPLIGLVEPEKLKPGDLIGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTESYADIGGLDKQVEELVEAVVLPMQQAEKFKNLGIKPPKGALMYGPPGTGKTLLARACAAQSNATFLKLAAPQLVQMFIGDGAKLVRDAFELAKEKAPTIIFIDELDAIGTKRFDSDKSGDREVQRTMLELLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPAEESRAQILQIHARKMTVDSSVNWKELARSTDEFNGAQLKAVTVEAGMIALRNGQSVVKHEDFVEGIGEVQARKTKSVSFYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.11
5 0.13
6 0.13
7 0.13
8 0.11
9 0.11
10 0.14
11 0.15
12 0.21
13 0.25
14 0.32
15 0.38
16 0.41
17 0.45
18 0.48
19 0.51
20 0.55
21 0.58
22 0.56
23 0.57
24 0.59
25 0.55
26 0.5
27 0.48
28 0.42
29 0.39
30 0.39
31 0.38
32 0.39
33 0.44
34 0.47
35 0.48
36 0.49
37 0.45
38 0.42
39 0.41
40 0.45
41 0.43
42 0.45
43 0.45
44 0.48
45 0.55
46 0.61
47 0.65
48 0.65
49 0.69
50 0.73
51 0.8
52 0.82
53 0.84
54 0.86
55 0.85
56 0.83
57 0.78
58 0.72
59 0.65
60 0.59
61 0.52
62 0.44
63 0.35
64 0.27
65 0.23
66 0.19
67 0.15
68 0.1
69 0.06
70 0.05
71 0.04
72 0.05
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.04
85 0.05
86 0.05
87 0.06
88 0.07
89 0.08
90 0.08
91 0.08
92 0.08
93 0.09
94 0.15
95 0.21
96 0.24
97 0.27
98 0.27
99 0.3
100 0.37
101 0.41
102 0.36
103 0.32
104 0.29
105 0.32
106 0.32
107 0.31
108 0.23
109 0.18
110 0.17
111 0.16
112 0.15
113 0.08
114 0.1
115 0.1
116 0.09
117 0.12
118 0.11
119 0.11
120 0.11
121 0.11
122 0.14
123 0.15
124 0.18
125 0.18
126 0.21
127 0.2
128 0.2
129 0.2
130 0.15
131 0.13
132 0.11
133 0.09
134 0.06
135 0.07
136 0.08
137 0.08
138 0.08
139 0.09
140 0.08
141 0.08
142 0.11
143 0.11
144 0.12
145 0.11
146 0.11
147 0.11
148 0.13
149 0.21
150 0.19
151 0.23
152 0.22
153 0.22
154 0.23
155 0.21
156 0.2
157 0.11
158 0.11
159 0.07
160 0.07
161 0.06
162 0.07
163 0.07
164 0.07
165 0.07
166 0.06
167 0.06
168 0.05
169 0.05
170 0.05
171 0.04
172 0.04
173 0.04
174 0.04
175 0.03
176 0.04
177 0.04
178 0.03
179 0.03
180 0.04
181 0.05
182 0.07
183 0.09
184 0.1
185 0.11
186 0.12
187 0.19
188 0.19
189 0.26
190 0.32
191 0.33
192 0.32
193 0.33
194 0.34
195 0.28
196 0.27
197 0.2
198 0.17
199 0.17
200 0.16
201 0.15
202 0.13
203 0.13
204 0.14
205 0.13
206 0.09
207 0.07
208 0.11
209 0.11
210 0.12
211 0.12
212 0.12
213 0.13
214 0.14
215 0.13
216 0.1
217 0.1
218 0.13
219 0.13
220 0.13
221 0.12
222 0.1
223 0.13
224 0.12
225 0.13
226 0.1
227 0.1
228 0.1
229 0.11
230 0.11
231 0.08
232 0.07
233 0.07
234 0.06
235 0.06
236 0.05
237 0.05
238 0.04
239 0.04
240 0.05
241 0.04
242 0.04
243 0.05
244 0.06
245 0.07
246 0.11
247 0.14
248 0.16
249 0.19
250 0.19
251 0.19
252 0.2
253 0.2
254 0.16
255 0.16
256 0.15
257 0.12
258 0.11
259 0.12
260 0.09
261 0.09
262 0.08
263 0.06
264 0.06
265 0.07
266 0.07
267 0.05
268 0.07
269 0.08
270 0.09
271 0.14
272 0.19
273 0.25
274 0.31
275 0.35
276 0.37
277 0.39
278 0.41
279 0.37
280 0.35
281 0.28
282 0.24
283 0.22
284 0.19
285 0.17
286 0.16
287 0.16
288 0.15
289 0.15
290 0.13
291 0.11
292 0.1
293 0.11
294 0.09
295 0.1
296 0.09
297 0.1
298 0.1
299 0.11
300 0.11
301 0.09
302 0.14
303 0.16
304 0.18
305 0.2
306 0.2
307 0.21
308 0.21
309 0.21
310 0.16
311 0.14
312 0.13
313 0.11
314 0.11
315 0.14
316 0.13
317 0.13
318 0.16
319 0.21
320 0.24
321 0.29
322 0.32
323 0.31
324 0.36
325 0.42
326 0.42
327 0.37
328 0.33
329 0.33
330 0.35
331 0.34
332 0.33
333 0.28
334 0.27
335 0.27
336 0.25
337 0.2
338 0.17
339 0.2
340 0.24
341 0.28
342 0.29
343 0.28
344 0.28
345 0.29
346 0.28
347 0.27
348 0.23
349 0.2
350 0.19
351 0.28
352 0.31
353 0.31
354 0.3
355 0.28
356 0.27
357 0.29
358 0.3
359 0.27
360 0.25
361 0.28
362 0.33
363 0.35
364 0.32
365 0.29
366 0.31
367 0.25
368 0.25
369 0.21
370 0.16
371 0.15
372 0.15
373 0.13
374 0.08
375 0.08
376 0.06
377 0.06
378 0.06
379 0.05
380 0.05
381 0.07
382 0.07
383 0.08
384 0.09
385 0.1
386 0.12
387 0.16
388 0.25
389 0.24
390 0.25
391 0.25
392 0.27
393 0.26
394 0.25
395 0.21
396 0.13
397 0.11
398 0.12
399 0.13
400 0.11
401 0.14
402 0.18
403 0.19
404 0.2
405 0.22
406 0.26