Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A099NTQ4

Protein Details
Accession A0A099NTQ4   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-26AHSLRSKSKLKAKKVKTSNPNSDYFHydrophilic
81-108VKTHGWRKSRAANYKKKKASKKNKSLKFHydrophilic
NLS Segment(s)
PositionSequence
11-14LKAK
86-108WRKSRAANYKKKKASKKNKSLKF
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAHSLRSKSKLKAKKVKTSNPNSDYFKTQESRSQRLAEKLKENLEKQAAAKVTATDSKDPDEMDTDTPKTLQTPAEELVNVKTHGWRKSRAANYKKKKASKKNKSLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.86
4 0.86
5 0.87
6 0.87
7 0.81
8 0.79
9 0.75
10 0.67
11 0.61
12 0.53
13 0.49
14 0.4
15 0.37
16 0.37
17 0.38
18 0.41
19 0.4
20 0.42
21 0.4
22 0.46
23 0.51
24 0.48
25 0.47
26 0.45
27 0.48
28 0.48
29 0.46
30 0.42
31 0.37
32 0.33
33 0.29
34 0.29
35 0.23
36 0.18
37 0.18
38 0.14
39 0.13
40 0.15
41 0.16
42 0.14
43 0.14
44 0.15
45 0.16
46 0.15
47 0.14
48 0.13
49 0.13
50 0.13
51 0.15
52 0.14
53 0.14
54 0.14
55 0.14
56 0.12
57 0.12
58 0.12
59 0.11
60 0.14
61 0.14
62 0.16
63 0.16
64 0.15
65 0.17
66 0.18
67 0.17
68 0.14
69 0.19
70 0.23
71 0.3
72 0.33
73 0.36
74 0.39
75 0.48
76 0.58
77 0.63
78 0.68
79 0.72
80 0.79
81 0.84
82 0.88
83 0.88
84 0.89
85 0.9
86 0.91
87 0.91
88 0.92