Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2U9QYA8

Protein Details
Accession A0A2U9QYA8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-54SLSVIKKKTTKPVSKKKQRSLAKSAKVHydrophilic
NLS Segment(s)
PositionSequence
32-50IKKKTTKPVSKKKQRSLAK
Subcellular Location(s) nucl 23, cyto_nucl 14.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTLHQTKLKTNQAENKTMKDKKTLNKESLSVIKKKTTKPVSKKKQRSLAKSAKVMIEKMNNNTTDDDIMNIMMSMETQTDTKAVASGNESDEAEELKKQHGLTSLKSDNLKKDLLNDERTLQKQEQVKNDISEQLKLIDQFTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.65
4 0.65
5 0.59
6 0.58
7 0.6
8 0.59
9 0.67
10 0.67
11 0.63
12 0.61
13 0.61
14 0.57
15 0.59
16 0.55
17 0.49
18 0.44
19 0.46
20 0.48
21 0.5
22 0.55
23 0.56
24 0.61
25 0.67
26 0.75
27 0.78
28 0.84
29 0.91
30 0.89
31 0.89
32 0.87
33 0.85
34 0.84
35 0.82
36 0.78
37 0.72
38 0.65
39 0.59
40 0.52
41 0.45
42 0.38
43 0.35
44 0.3
45 0.3
46 0.32
47 0.28
48 0.28
49 0.28
50 0.25
51 0.19
52 0.17
53 0.13
54 0.09
55 0.08
56 0.07
57 0.06
58 0.05
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.06
70 0.05
71 0.06
72 0.07
73 0.08
74 0.09
75 0.1
76 0.1
77 0.1
78 0.1
79 0.1
80 0.1
81 0.1
82 0.09
83 0.1
84 0.12
85 0.12
86 0.13
87 0.2
88 0.22
89 0.23
90 0.31
91 0.32
92 0.34
93 0.38
94 0.39
95 0.36
96 0.37
97 0.36
98 0.28
99 0.31
100 0.36
101 0.37
102 0.39
103 0.36
104 0.37
105 0.42
106 0.43
107 0.44
108 0.36
109 0.36
110 0.38
111 0.42
112 0.47
113 0.46
114 0.48
115 0.45
116 0.46
117 0.48
118 0.43
119 0.39
120 0.32
121 0.28
122 0.27
123 0.25