Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z8JVU3

Protein Details
Accession A0A1Z8JVU3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
161-180QGEEKKKYEKKLEKEEYDKIBasic
NLS Segment(s)
Subcellular Location(s) plas 14, E.R. 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018815  Incr_loss_mito_DNA_1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10311  Ilm1  
Amino Acid Sequences MALFSARTLIGARIALLTFVAYHLLVSPRTVIEYSGVLVLASSMDLPLLMVNEKSPIYGTIGVVLITLLLSDIAALLDGNMKYFETTVFCRLLFFFPLCAYCYLGTWVVLCNSVIFSYAFIEAWFGILTFSTLKEEKMNRARDHAKKEAEIKEKYERGELQGEEKKKYEKKLEKEEYDKIMNEFKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.07
6 0.07
7 0.08
8 0.06
9 0.06
10 0.08
11 0.1
12 0.1
13 0.11
14 0.12
15 0.11
16 0.13
17 0.13
18 0.12
19 0.11
20 0.11
21 0.11
22 0.11
23 0.1
24 0.08
25 0.07
26 0.07
27 0.05
28 0.05
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.05
37 0.05
38 0.05
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.1
45 0.12
46 0.11
47 0.11
48 0.11
49 0.11
50 0.1
51 0.09
52 0.06
53 0.04
54 0.04
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.09
74 0.11
75 0.12
76 0.12
77 0.12
78 0.13
79 0.13
80 0.12
81 0.11
82 0.09
83 0.08
84 0.09
85 0.1
86 0.1
87 0.1
88 0.09
89 0.09
90 0.1
91 0.1
92 0.09
93 0.08
94 0.08
95 0.07
96 0.08
97 0.07
98 0.06
99 0.06
100 0.06
101 0.07
102 0.06
103 0.06
104 0.07
105 0.07
106 0.07
107 0.06
108 0.07
109 0.06
110 0.06
111 0.06
112 0.05
113 0.04
114 0.04
115 0.05
116 0.05
117 0.06
118 0.08
119 0.09
120 0.1
121 0.15
122 0.18
123 0.26
124 0.34
125 0.41
126 0.39
127 0.47
128 0.55
129 0.57
130 0.63
131 0.62
132 0.58
133 0.54
134 0.61
135 0.62
136 0.61
137 0.56
138 0.53
139 0.54
140 0.54
141 0.51
142 0.49
143 0.42
144 0.38
145 0.41
146 0.37
147 0.36
148 0.4
149 0.42
150 0.4
151 0.41
152 0.46
153 0.46
154 0.53
155 0.55
156 0.57
157 0.64
158 0.72
159 0.79
160 0.79
161 0.8
162 0.79
163 0.75
164 0.69
165 0.62
166 0.53