Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IPW7

Protein Details
Accession A0A395IPW7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-41SLQPPFPQRAHPPRKRQPPLPLPPLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MFFKRSNMFKTYLQISLQPPFPQRAHPPRKRQPPLPLPPLFQTLNIASPRAPSQNSPRIPPSANADTVSKYGRNNVNTPSTAAPTVAPTAHPTSGQTVKDAAATIPSCGKNGSTTRPGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.34
4 0.35
5 0.33
6 0.32
7 0.34
8 0.34
9 0.35
10 0.41
11 0.48
12 0.56
13 0.61
14 0.7
15 0.74
16 0.85
17 0.86
18 0.83
19 0.83
20 0.82
21 0.82
22 0.8
23 0.73
24 0.65
25 0.6
26 0.57
27 0.46
28 0.36
29 0.3
30 0.21
31 0.23
32 0.21
33 0.19
34 0.14
35 0.15
36 0.17
37 0.16
38 0.16
39 0.14
40 0.22
41 0.3
42 0.31
43 0.33
44 0.33
45 0.33
46 0.34
47 0.32
48 0.3
49 0.25
50 0.24
51 0.23
52 0.21
53 0.2
54 0.2
55 0.21
56 0.16
57 0.13
58 0.18
59 0.22
60 0.24
61 0.25
62 0.27
63 0.3
64 0.29
65 0.32
66 0.27
67 0.24
68 0.21
69 0.19
70 0.16
71 0.13
72 0.14
73 0.12
74 0.11
75 0.12
76 0.15
77 0.15
78 0.15
79 0.15
80 0.19
81 0.25
82 0.24
83 0.22
84 0.2
85 0.2
86 0.21
87 0.2
88 0.15
89 0.15
90 0.15
91 0.15
92 0.2
93 0.21
94 0.2
95 0.21
96 0.21
97 0.22
98 0.26
99 0.32
100 0.33