Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J2Z2

Protein Details
Accession A0A395J2Z2   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-29NSSSTPSTKRVKKESSRSSSVTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.499, cyto_nucl 9.833, mito 7.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001025  BAH_dom  
IPR043151  BAH_sf  
IPR011011  Znf_FYVE_PHD  
Gene Ontology GO:0003682  F:chromatin binding  
PROSITE View protein in PROSITE  
PS51038  BAH  
CDD cd04370  BAH  
Amino Acid Sequences MAPKHGRNSSSTPSTKRVKKESSRSSSVTPPPAVQDAVAFSIKYPIMNPMDGNEEYNNFIIQSETYKSNETVYVKGKTEAGIEPKDFWVARVLQVRASNPQHVYALVAWMYWPEELEATAKAADEVSPAGGRRKYHGSAELIASNYLDVVDVTSFAGKVEIVHFSEEVVDDAVSEPNLKKFYWRQTFCRGTNKLSDLPVYCICNGHYNPDLLEYEHVCDNEACKTLYHSECLVEDTLTKKVLRGIPSKWNGASNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.68
4 0.69
5 0.7
6 0.74
7 0.79
8 0.82
9 0.81
10 0.81
11 0.76
12 0.71
13 0.7
14 0.66
15 0.62
16 0.53
17 0.45
18 0.42
19 0.4
20 0.36
21 0.27
22 0.22
23 0.17
24 0.18
25 0.18
26 0.14
27 0.12
28 0.16
29 0.16
30 0.15
31 0.14
32 0.17
33 0.19
34 0.2
35 0.2
36 0.17
37 0.22
38 0.22
39 0.24
40 0.19
41 0.17
42 0.18
43 0.19
44 0.17
45 0.12
46 0.11
47 0.1
48 0.09
49 0.11
50 0.12
51 0.14
52 0.15
53 0.17
54 0.18
55 0.18
56 0.22
57 0.22
58 0.23
59 0.25
60 0.28
61 0.27
62 0.27
63 0.27
64 0.23
65 0.23
66 0.22
67 0.22
68 0.21
69 0.21
70 0.21
71 0.21
72 0.23
73 0.21
74 0.18
75 0.17
76 0.14
77 0.18
78 0.22
79 0.22
80 0.23
81 0.25
82 0.26
83 0.29
84 0.3
85 0.3
86 0.25
87 0.26
88 0.23
89 0.21
90 0.21
91 0.14
92 0.13
93 0.09
94 0.08
95 0.06
96 0.06
97 0.07
98 0.05
99 0.05
100 0.04
101 0.04
102 0.05
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.05
115 0.06
116 0.09
117 0.11
118 0.11
119 0.14
120 0.18
121 0.19
122 0.21
123 0.24
124 0.23
125 0.23
126 0.24
127 0.23
128 0.19
129 0.17
130 0.15
131 0.11
132 0.09
133 0.07
134 0.05
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.04
145 0.05
146 0.05
147 0.07
148 0.08
149 0.09
150 0.09
151 0.09
152 0.09
153 0.09
154 0.08
155 0.07
156 0.06
157 0.05
158 0.06
159 0.07
160 0.06
161 0.07
162 0.08
163 0.1
164 0.12
165 0.12
166 0.16
167 0.22
168 0.32
169 0.42
170 0.46
171 0.49
172 0.57
173 0.65
174 0.65
175 0.69
176 0.62
177 0.55
178 0.57
179 0.56
180 0.49
181 0.42
182 0.41
183 0.32
184 0.34
185 0.33
186 0.29
187 0.25
188 0.23
189 0.23
190 0.27
191 0.26
192 0.26
193 0.25
194 0.23
195 0.23
196 0.25
197 0.25
198 0.19
199 0.21
200 0.17
201 0.18
202 0.19
203 0.19
204 0.17
205 0.17
206 0.17
207 0.18
208 0.19
209 0.17
210 0.15
211 0.18
212 0.24
213 0.26
214 0.27
215 0.25
216 0.24
217 0.24
218 0.27
219 0.24
220 0.17
221 0.17
222 0.17
223 0.19
224 0.2
225 0.19
226 0.18
227 0.24
228 0.29
229 0.33
230 0.37
231 0.39
232 0.47
233 0.52
234 0.57
235 0.52