Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IWW9

Protein Details
Accession A0A395IWW9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-64STDQSDKPKKKRHPLPRDLPPGFBasic
NLS Segment(s)
PositionSequence
49-55PKKKRHP
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MVTKSQLSYTKISKKFLRLLKGWKSLRLQIGYSHKTPQFTFSTDQSDKPKKKRHPLPRDLPPGFKASFTARNGVIIEADIQYDDNGETVQMGRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.61
4 0.6
5 0.56
6 0.61
7 0.64
8 0.68
9 0.63
10 0.61
11 0.58
12 0.56
13 0.56
14 0.49
15 0.41
16 0.38
17 0.44
18 0.42
19 0.4
20 0.4
21 0.36
22 0.36
23 0.35
24 0.33
25 0.26
26 0.25
27 0.26
28 0.22
29 0.29
30 0.28
31 0.31
32 0.34
33 0.41
34 0.43
35 0.49
36 0.57
37 0.57
38 0.66
39 0.73
40 0.77
41 0.79
42 0.83
43 0.84
44 0.85
45 0.87
46 0.79
47 0.72
48 0.62
49 0.55
50 0.46
51 0.37
52 0.29
53 0.23
54 0.29
55 0.27
56 0.28
57 0.24
58 0.25
59 0.26
60 0.24
61 0.19
62 0.12
63 0.12
64 0.09
65 0.1
66 0.08
67 0.08
68 0.07
69 0.08
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07