Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IYD7

Protein Details
Accession A0A395IYD7   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-72SEPPPKPKKSTKGKPAAKKGKKSKILKRRVMRKNEGVEBasic
NLS Segment(s)
PositionSequence
38-67PPKPKKSTKGKPAAKKGKKSKILKRRVMRK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, plas 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKKEDEIEEKPSLNETSEEEEEEEASIETDSNSDSEPPPKPKKSTKGKPAAKKGKKSKILKRRVMRKNEGVEFVLLSIVAMGVVGLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.22
4 0.21
5 0.22
6 0.2
7 0.19
8 0.18
9 0.17
10 0.15
11 0.08
12 0.07
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.06
20 0.07
21 0.07
22 0.12
23 0.16
24 0.24
25 0.32
26 0.35
27 0.4
28 0.46
29 0.55
30 0.61
31 0.66
32 0.68
33 0.72
34 0.76
35 0.8
36 0.84
37 0.85
38 0.82
39 0.83
40 0.83
41 0.82
42 0.84
43 0.84
44 0.83
45 0.83
46 0.86
47 0.85
48 0.85
49 0.86
50 0.85
51 0.86
52 0.84
53 0.82
54 0.8
55 0.74
56 0.68
57 0.58
58 0.5
59 0.4
60 0.32
61 0.23
62 0.14
63 0.1
64 0.06
65 0.05
66 0.04
67 0.03
68 0.02