Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IGY5

Protein Details
Accession A0A395IGY5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
260-281YWQEKRRIPTKGKEQNRKTWSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019680  Mediator_Med1  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF10744  Med1  
Amino Acid Sequences MATPTPGKYPGVAATPPVSTPFSTSHLAFSLLMGRVPLYLPPLRSRNPVLQACRIKDINMGIGYDSPSAALALGMGADPNKGRLSEAGLERLACRVGLECLWEDMMGSASNGRTLIIAGNALALDIEFANNIVQKVSLSFPDAPESVTKHEKTASDILLNDLRFEAGEGPLTKMLDRFAANLERLTMLDKLSVIPGLNCHEAVAGIFCSLDKLHSWELGRLKENDMLGMGDEEIMKAAMCIRSGIPVMHSRERLGLSLDYWQEKRRIPTKGKEQNRKTWSLLVEVAPLPSLVVGVYTPLRVSDKWISDDIQQADPVVDDLFQAAQLRAGERPNSGLVGARQHVLTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.23
5 0.22
6 0.18
7 0.2
8 0.21
9 0.23
10 0.25
11 0.25
12 0.24
13 0.23
14 0.25
15 0.22
16 0.19
17 0.21
18 0.18
19 0.18
20 0.15
21 0.14
22 0.13
23 0.13
24 0.14
25 0.13
26 0.16
27 0.19
28 0.25
29 0.31
30 0.34
31 0.39
32 0.43
33 0.45
34 0.51
35 0.55
36 0.54
37 0.58
38 0.62
39 0.6
40 0.61
41 0.54
42 0.46
43 0.42
44 0.39
45 0.34
46 0.28
47 0.25
48 0.19
49 0.2
50 0.21
51 0.17
52 0.15
53 0.1
54 0.09
55 0.08
56 0.07
57 0.06
58 0.04
59 0.03
60 0.04
61 0.03
62 0.04
63 0.04
64 0.05
65 0.05
66 0.07
67 0.08
68 0.08
69 0.09
70 0.1
71 0.14
72 0.19
73 0.21
74 0.23
75 0.23
76 0.23
77 0.23
78 0.23
79 0.18
80 0.12
81 0.11
82 0.08
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.11
89 0.1
90 0.09
91 0.08
92 0.08
93 0.06
94 0.06
95 0.07
96 0.06
97 0.07
98 0.07
99 0.07
100 0.06
101 0.06
102 0.07
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.05
118 0.06
119 0.05
120 0.05
121 0.05
122 0.07
123 0.08
124 0.08
125 0.1
126 0.11
127 0.11
128 0.14
129 0.14
130 0.13
131 0.14
132 0.15
133 0.16
134 0.2
135 0.2
136 0.19
137 0.21
138 0.21
139 0.23
140 0.25
141 0.22
142 0.18
143 0.18
144 0.19
145 0.2
146 0.19
147 0.16
148 0.12
149 0.11
150 0.09
151 0.09
152 0.08
153 0.05
154 0.07
155 0.07
156 0.08
157 0.09
158 0.1
159 0.09
160 0.09
161 0.09
162 0.09
163 0.09
164 0.09
165 0.1
166 0.12
167 0.13
168 0.12
169 0.13
170 0.11
171 0.11
172 0.12
173 0.1
174 0.08
175 0.08
176 0.08
177 0.07
178 0.07
179 0.08
180 0.06
181 0.06
182 0.07
183 0.1
184 0.1
185 0.1
186 0.09
187 0.09
188 0.09
189 0.09
190 0.08
191 0.05
192 0.04
193 0.04
194 0.04
195 0.05
196 0.05
197 0.06
198 0.05
199 0.09
200 0.1
201 0.13
202 0.14
203 0.18
204 0.22
205 0.25
206 0.28
207 0.25
208 0.27
209 0.27
210 0.26
211 0.21
212 0.18
213 0.14
214 0.12
215 0.11
216 0.08
217 0.06
218 0.06
219 0.05
220 0.05
221 0.05
222 0.04
223 0.04
224 0.06
225 0.06
226 0.07
227 0.08
228 0.08
229 0.1
230 0.11
231 0.11
232 0.12
233 0.18
234 0.23
235 0.27
236 0.28
237 0.27
238 0.29
239 0.3
240 0.28
241 0.24
242 0.2
243 0.15
244 0.2
245 0.21
246 0.22
247 0.23
248 0.25
249 0.27
250 0.3
251 0.36
252 0.38
253 0.44
254 0.47
255 0.55
256 0.64
257 0.69
258 0.76
259 0.8
260 0.81
261 0.82
262 0.81
263 0.77
264 0.69
265 0.65
266 0.56
267 0.49
268 0.44
269 0.35
270 0.32
271 0.27
272 0.25
273 0.19
274 0.17
275 0.13
276 0.09
277 0.08
278 0.04
279 0.04
280 0.04
281 0.06
282 0.07
283 0.07
284 0.08
285 0.09
286 0.12
287 0.12
288 0.19
289 0.24
290 0.27
291 0.31
292 0.33
293 0.33
294 0.33
295 0.4
296 0.37
297 0.32
298 0.28
299 0.25
300 0.23
301 0.21
302 0.19
303 0.12
304 0.09
305 0.07
306 0.07
307 0.07
308 0.08
309 0.1
310 0.09
311 0.11
312 0.12
313 0.14
314 0.16
315 0.2
316 0.21
317 0.21
318 0.24
319 0.23
320 0.23
321 0.21
322 0.23
323 0.21
324 0.26
325 0.26
326 0.25