Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395J8Y8

Protein Details
Accession A0A395J8Y8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-50MEIEKERKGKERKGKERKFHCTIBasic
NLS Segment(s)
PositionSequence
32-45KERKGKERKGKERK
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
Amino Acid Sequences MTDNLGRTENMGFMYMSDERRERKMYIMEIEKERKGKERKGKERKFHCTIAFWGQDILVLNLMDGWIWMDLWVIEVLWGCFDWRGWRGRGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.18
5 0.21
6 0.23
7 0.27
8 0.31
9 0.27
10 0.3
11 0.33
12 0.33
13 0.36
14 0.39
15 0.39
16 0.42
17 0.45
18 0.43
19 0.41
20 0.39
21 0.41
22 0.41
23 0.45
24 0.49
25 0.56
26 0.64
27 0.73
28 0.8
29 0.81
30 0.85
31 0.84
32 0.8
33 0.73
34 0.64
35 0.55
36 0.49
37 0.46
38 0.37
39 0.29
40 0.23
41 0.18
42 0.18
43 0.16
44 0.13
45 0.08
46 0.07
47 0.07
48 0.06
49 0.06
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.06
59 0.06
60 0.05
61 0.05
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.13
70 0.16
71 0.22