Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395J4F9

Protein Details
Accession A0A395J4F9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-51EPTFNRIRFHQPPRKNKYKKQILEQEQRTRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, plas 11, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQDAPSNGGRRLPNRARIRFAEPTFNRIRFHQPPRKNKYKKQILEQEQRTRTPKAPAPALPIFVSYLTIGPLFVICYRSSKQETNVFIYRTGMNLNLIPFPDLSFILLSCLVSVAVQPTFMTKQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.64
4 0.64
5 0.68
6 0.66
7 0.61
8 0.62
9 0.53
10 0.54
11 0.55
12 0.53
13 0.47
14 0.41
15 0.48
16 0.46
17 0.55
18 0.58
19 0.61
20 0.69
21 0.77
22 0.85
23 0.85
24 0.84
25 0.85
26 0.85
27 0.82
28 0.81
29 0.82
30 0.8
31 0.82
32 0.81
33 0.8
34 0.73
35 0.71
36 0.64
37 0.57
38 0.5
39 0.45
40 0.41
41 0.35
42 0.35
43 0.33
44 0.36
45 0.34
46 0.33
47 0.27
48 0.24
49 0.2
50 0.16
51 0.15
52 0.08
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.07
62 0.07
63 0.1
64 0.12
65 0.16
66 0.2
67 0.22
68 0.26
69 0.31
70 0.34
71 0.37
72 0.4
73 0.37
74 0.33
75 0.33
76 0.29
77 0.22
78 0.2
79 0.15
80 0.12
81 0.12
82 0.13
83 0.13
84 0.13
85 0.13
86 0.12
87 0.12
88 0.12
89 0.11
90 0.11
91 0.1
92 0.09
93 0.1
94 0.11
95 0.1
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.08
105 0.12