Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395ITS1

Protein Details
Accession A0A395ITS1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-60QIHFQQQHQQHQQRQPQRQRQQHQHQHQHQPYLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 6, cysk 3, mito 2, plas 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
CDD cd14705  bZIP_Zip1  
Amino Acid Sequences MYPSIAPIPTIESDVLYQSQHFDPQPQIHFQQQHQQHQQRQPQRQRQQHQHQHQHQPYLDPTLAEHDLRIFTQGPAHNPSYDTPIAPYPASDSSEGPIDMWGGVLNWVDGQNSSMPMHQYLHTQPHHRHLSSARFRQKKKQREMSLEMSVKEQKERIGMMECRIRELEGENGFLKELVMGRIKWKEEKDDEENDNEENDNEKGKEKDDGKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.14
4 0.14
5 0.15
6 0.16
7 0.19
8 0.19
9 0.2
10 0.25
11 0.31
12 0.34
13 0.35
14 0.37
15 0.4
16 0.44
17 0.43
18 0.46
19 0.48
20 0.54
21 0.6
22 0.65
23 0.67
24 0.71
25 0.79
26 0.79
27 0.82
28 0.83
29 0.83
30 0.85
31 0.87
32 0.87
33 0.89
34 0.9
35 0.9
36 0.9
37 0.9
38 0.89
39 0.9
40 0.84
41 0.8
42 0.7
43 0.63
44 0.54
45 0.48
46 0.39
47 0.28
48 0.24
49 0.22
50 0.22
51 0.18
52 0.17
53 0.13
54 0.13
55 0.13
56 0.15
57 0.11
58 0.09
59 0.15
60 0.17
61 0.18
62 0.22
63 0.24
64 0.22
65 0.22
66 0.23
67 0.23
68 0.22
69 0.19
70 0.16
71 0.16
72 0.17
73 0.15
74 0.14
75 0.11
76 0.12
77 0.14
78 0.13
79 0.12
80 0.12
81 0.13
82 0.13
83 0.1
84 0.09
85 0.07
86 0.06
87 0.06
88 0.05
89 0.03
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.07
100 0.07
101 0.08
102 0.08
103 0.09
104 0.11
105 0.11
106 0.13
107 0.14
108 0.21
109 0.23
110 0.27
111 0.28
112 0.36
113 0.4
114 0.38
115 0.38
116 0.36
117 0.44
118 0.48
119 0.55
120 0.56
121 0.58
122 0.61
123 0.69
124 0.74
125 0.74
126 0.76
127 0.77
128 0.75
129 0.76
130 0.8
131 0.75
132 0.74
133 0.66
134 0.56
135 0.49
136 0.45
137 0.37
138 0.32
139 0.27
140 0.19
141 0.19
142 0.19
143 0.18
144 0.21
145 0.22
146 0.25
147 0.3
148 0.29
149 0.29
150 0.29
151 0.27
152 0.21
153 0.22
154 0.24
155 0.2
156 0.22
157 0.2
158 0.2
159 0.2
160 0.19
161 0.17
162 0.11
163 0.11
164 0.11
165 0.13
166 0.14
167 0.19
168 0.25
169 0.28
170 0.33
171 0.35
172 0.4
173 0.42
174 0.49
175 0.5
176 0.52
177 0.52
178 0.5
179 0.49
180 0.41
181 0.37
182 0.3
183 0.24
184 0.2
185 0.18
186 0.18
187 0.18
188 0.21
189 0.22
190 0.23
191 0.31
192 0.31